RegulonDB RegulonDB 10.9: Gene Form
   

cbl gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cbl nac asnU cblp cblp yeeOp6 yeeOp6 TSS_2299 TSS_2299

Gene      
Name: cbl    Texpresso search in the literature
Synonym(s): ECK1982, G7071, b1987
Genome position(nucleotides): 2059964 <-- 2060914 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.26
External database links:  
ASAP:
ABE-0006590
ECHOBASE:
EB4012
ECOLIHUB:
cbl
OU-MICROARRAY:
b1987
STRING:
511145.b1987
COLOMBOS: cbl


Product      
Name: DNA-binding transcriptional activator Cbl
Synonym(s): Cbl
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 35.856
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
143 -> 143 A
19 -> 38 LTEVANMLFTSQSGVSRHIR
1 -> 59 MNFQQLKIIREAARQDYNLTEVANMLFTSQSGVSRHIRELEDELGIEIFVRRGKRLLGM
90 -> 293 DTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNA
3 -> 63 FQQLKIIREAARQDYNLTEVANMLFTSQSGVSRHIRELEDELGIEIFVRRGKRLLGMTEPG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.12 - cysteine
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0019344 - cysteine biosynthetic process
GO:0045883 - positive regulation of sulfur utilization
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-9248N
ECOCYC:
G7071-MONOMER
ECOLIWIKI:
b1987
INTERPRO:
IPR037408
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR000847
INTERPRO:
IPR005119
MODBASE:
Q47083
PDB:
2FYI
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
Q47083
PRINTS:
PR00039
PRODB:
PRO_000022249
PROSITE:
PS50931
REFSEQ:
NP_416492
SMR:
Q47083
SWISSMODEL:
Q47083
UNIPROT:
Q47083


Operon      
Name: cbl         
Operon arrangement:
Transcription unit        Promoter
cbl


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2299 2059851 forward nd [RS-EPT-CBR] [1]
  promoter yeeOp6 2059875 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB