RegulonDB RegulonDB 10.8: Gene Form
   

insH6 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD3 insH6 insD3 cobU yoeG insC3 yoeH yeeH cobS anti-anti-terminator anti-terminator terminator TSS_2309 TSS_2309 TSS_2308 TSS_2308 TSS_2307 TSS_2307 insHp4 insHp4 insHp2 insHp2 TSS_2306 TSS_2306 TSS_2305 TSS_2305 cobUp2 cobUp2 cobUp1 cobUp1 TSS_2304 TSS_2304

Gene      
Name: insH6    Texpresso search in the literature
Synonym(s): ECK0261, G7074, b1994, trs5-6, yi52_6
Genome position(nucleotides): 2066305 <-- 2067285 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.94
External database links:  
ASAP:
ABE-0006619
ECHOBASE:
EB4730
OU-MICROARRAY:
b1994
PortEco:
insH-6
STRING:
511145.b1994
COLOMBOS: insH6


Product      
Name: CP4-44 prophage; IS5 transposase and trans-activator
Synonym(s): InsH6, Trs5-6, Yi52_6
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.823
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRAKVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7074-MONOMER
ECOLIWIKI:
b1994
INTERPRO:
IPR002559
INTERPRO:
IPR008490
PFAM:
PF01609
PFAM:
PF05598
PRIDE:
P0CE53
PRODB:
PRO_000023022
REFSEQ:
NP_416498
UNIPROT:
P0CE53


Operon      
Name: insH6         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2304 2065847 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2305 2065996 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2306 2067312 reverse nd [RS-EPT-CBR] [1]
  promoter insHp2 2067498 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2067511 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2307 2067918 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2308 2067920 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2309 2067984 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB