RegulonDB RegulonDB 10.8: Gene Form
   

insD3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD3 insD3 yeeP insC3 yoeH TSS_2310 (cluster) TSS_2310 (cluster)

Gene      
Name: insD3    Texpresso search in the literature
Synonym(s): ECK0358, G7076, b1996, yi22-3
Genome position(nucleotides): 2068952 <-- 2069857 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.08
External database links:  
ASAP:
ABE-0006629
ECOO157CYC:
Z0322
OU-MICROARRAY:
b1996
PortEco:
insD-3
COLOMBOS: insD3


Product      
Name: CP4-44 prophage; IS2 insertion element protein InsB
Synonym(s): InsD3
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 34.398
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
124 -> 243 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRD
62 -> 104 ELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
106 -> 289 KPAVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4446
INTERPRO:
IPR012337
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR001584
PFAM:
PF00665
PFAM:
PF13276
PRIDE:
P0CF55
PROSITE:
PS50994
REFSEQ:
NP_416500
SMR:
P0CF55
UNIPROT:
P0CF55


Operon      
Name: insCD3C3D3         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2306 2067312 reverse nd [RS-EPT-CBR] [1]
  promoter insHp2 2067498 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2067511 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2307 2067918 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2308 2067920 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2309 2067984 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2310 (cluster) 2070209 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2311 2071472 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB