RegulonDB RegulonDB 10.9: Gene Form
   

insC3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD3 insD3 yeeP insC3 isrC OxyR OxyR OxyR terminator anti-terminator anti-anti-terminator flup2 flup2 flup1 flup1 TSS_2311 TSS_2311 flup flup TSS_2310 (cluster) TSS_2310 (cluster)

Gene      
Name: insC3    Texpresso search in the literature
Synonym(s): ECK0357, G7077, b1997, yi21-3
Genome position(nucleotides): 2069815 <-- 2070180 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0006631
ECHOBASE:
EB4732
ECOLIHUB:
insC-3
ECOO157CYC:
Z1826
ECOO157CYC:
Z5096
ECOO157CYC:
Z4315
ECOO157CYC:
Z0365
ECOO157CYC:
Z1927
ECOO157CYC:
Z3154
OU-MICROARRAY:
b1997
STRING:
511145.b4272
COLOMBOS: insC3


Product      
Name: CP4-44 prophage; IS2 insertion element repressor InsA
Synonym(s): InsC3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.452
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4251
ECOLIWIKI:
b1997
INTERPRO:
IPR002514
INTERPRO:
IPR009057
PFAM:
PF01527
PRIDE:
P0CF42
REFSEQ:
YP_026163
UNIPROT:
P0CF42


Operon      
Name: insCD3C3D3         
Operon arrangement:
Transcription unit        Promoter
insC3D3CD3


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2306 2067312 reverse nd [RS-EPT-CBR] [1]
  promoter insHp2 2067498 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2067511 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2307 2067918 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2308 2067920 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2309 2067984 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2310 (cluster) 2070209 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2311 2071472 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB