RegulonDB RegulonDB 10.9: Gene Form
   

flu gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flu yeeR isrC yeeS OxyR OxyR terminator anti-terminator anti-anti-terminator flup2 flup2 flup1 flup1 TSS_2311 TSS_2311 flup flup

Gene      
Name: flu    Texpresso search in the literature
Synonym(s): ECK1993, G7080, agn, agn43, b2000, yeeQ, yzzX
Genome position(nucleotides): 2071539 --> 2074658 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.24
Reference(s): [1] Henderson IR., et al., 1999
External database links:  
ASAP:
ABE-0006642
ECHOBASE:
EB2550
ECOLIHUB:
flu
OU-MICROARRAY:
b2000
STRING:
511145.b2000
COLOMBOS: flu


Product      
Name: CP4-44 prophage; self recognizing antigen 43 (Ag43) autotransporter
Synonym(s): Ag43, Agn, Flu, YeeQ, YzzX
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,extracellular space,outer membrane
Molecular weight: 106.825
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
157 -> 157 W
396 -> 457 SGTRSDGKAFSIGGGQADALMLEKGSSFTLNAGDTATDTTVNGGLFTARGGTLAGTTTLNNG
497 -> 497 S
573 -> 690 SVVDDLSHAGQIHFTSTRTGKFVPATLKVKNLNGQNGTISLRVRPDMAQNNADRLVIDGGRATGKTILNLVNAGNSASGLATSGKGIQVVEAINGATTEEGAFVQGNRLQAGAFNYSL
1025 -> 1025 S

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0042597 - periplasmic space
GO:0005576 - extracellular region
GO:0016021 - integral component of membrane
GO:0009986 - cell surface
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [2] Chauhan A., et al., 2013
External database links:  
DIP:
DIP-2892N
ECOCYC:
G7080-MONOMER
ECOLIWIKI:
b2000
INTERPRO:
IPR024973
INTERPRO:
IPR012332
INTERPRO:
IPR011050
INTERPRO:
IPR005546
INTERPRO:
IPR030930
INTERPRO:
IPR036709
MODBASE:
P39180
PFAM:
PF18883
PFAM:
PF16168
PFAM:
PF13018
PFAM:
PF03797
PRIDE:
P39180
PRODB:
PRO_000022673
PROSITE:
PS51208
REFSEQ:
YP_026164
SMART:
SM00869
SMR:
P39180
UNIPROT:
P39180


Operon      
Name: isrC-flu         
Operon arrangement:
Transcription unit        Promoter
isrC-flu
flu
flu
isrC


Transcriptional Regulation      
Display Regulation             
Activated by: YdcI
Repressed by: OxyR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2311 2071472 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Henderson IR., Owen P., 1999, The major phase-variable outer membrane protein of Escherichia coli structurally resembles the immunoglobulin A1 protease class of exported protein and is regulated by a novel mechanism involving Dam and oxyR., J Bacteriol 181(7):2132-41

 [2] Chauhan A., Sakamoto C., Ghigo JM., Beloin C., 2013, Did I pick the right colony? Pitfalls in the study of regulation of the phase variable antigen 43 adhesin., PLoS One 8(9):e73568

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB