RegulonDB RegulonDB 10.9: Gene Form
   

yeeT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeS cbeA yeeT yeeR

Gene      
Name: yeeT    Texpresso search in the literature
Synonym(s): ECK1996, G7083, b2003
Genome position(nucleotides): 2076817 --> 2077038 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.7
External database links:  
ASAP:
ABE-0006653
ECHOBASE:
EB3168
ECOLIHUB:
yeeT
OU-MICROARRAY:
b2003
STRING:
511145.b2003
COLOMBOS: yeeT


Product      
Name: CP4-44 prophage; DUF987 domain-containing protein YeeT
Synonym(s): YeeT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.411
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
1 -> 65 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYV

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7083-MONOMER
ECOLIWIKI:
b2003
INTERPRO:
IPR009329
PFAM:
PF06174
PRIDE:
P64521
REFSEQ:
NP_416507
SMR:
P64521
UNIPROT:
P64521


Operon      
Name: yeeRST-cbeA-cbtA-yeeW         
Operon arrangement:
Transcription unit        Promoter
yeeRST-cbeA-cbtA-yeeW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB