RegulonDB RegulonDB 10.9: Gene Form
   

cbeA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cbtA cbeA yeeT yeeW

Gene      
Name: cbeA    Texpresso search in the literature
Synonym(s): ECK1997, G7084, b2004, yeeU
Genome position(nucleotides): 2077112 --> 2077480 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.18
External database links:  
ASAP:
ABE-0006656
ECHOBASE:
EB3169
ECOLIHUB:
yeeU
OU-MICROARRAY:
b2004
STRING:
511145.b2004
COLOMBOS: cbeA


Product      
Name: CP4-44 prophage; cytoskeleton bundling-enhancing antitoxin CbeA
Synonym(s): CP4-44 prophage; antitoxin of the CbtA-CbeA toxin-antitoxin system, CbeA, YeeU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.684
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
18 -> 117 PWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0008092 - cytoskeletal protein binding
biological_process GO:0031342 - negative regulation of cell killing
GO:0051495 - positive regulation of cytoskeleton organization
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
Reference(s): [1] Brown JM., et al., 2003
[2] Masuda H., et al., 2012
External database links:  
ECOCYC:
G7084-MONOMER
ECOLIWIKI:
b2004
INTERPRO:
IPR009320
INTERPRO:
IPR038025
PDB:
2H28
PFAM:
PF06154
PRIDE:
P76364
REFSEQ:
NP_416508
SMR:
P76364
UNIPROT:
P76364


Operon      
Name: yeeRST-cbeA-cbtA-yeeW         
Operon arrangement:
Transcription unit        Promoter
yeeRST-cbeA-cbtA-yeeW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brown JM., Shaw KJ., 2003, A novel family of Escherichia coli toxin-antitoxin gene pairs., J Bacteriol 185(22):6600-8

 [2] Masuda H., Tan Q., Awano N., Wu KP., Inouye M., 2012, YeeU enhances the bundling of cytoskeletal polymers of MreB and FtsZ, antagonizing the CbtA (YeeV) toxicity in Escherichia coli., Mol Microbiol 84(5):979-89


RegulonDB