RegulonDB RegulonDB 10.9: Gene Form
   

cbtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cbtA cbeA yeeW yoeD yoeF terminator anti-terminator anti-anti-terminator

Gene      
Name: cbtA    Texpresso search in the literature
Synonym(s): ECK1998, G7085, b2005, yeeV
Genome position(nucleotides): 2077569 --> 2077943 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0006659
ECHOBASE:
EB3170
ECOLIHUB:
yeeV
OU-MICROARRAY:
b2005
STRING:
511145.b2005
COLOMBOS: cbtA


Product      
Name: CP4-44 prophage; cytoskeleton-binding toxin CbtA
Synonym(s): CP4-44 prophage; toxin of the CbtA-CbeA toxin-antitoxin system, CbtA, YeeV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.899
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
1 -> 15 MKTLPVLPGQAASSR
15 -> 15 R
65 -> 65 F
74 -> 124 RTDQPGFSACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008092 - cytoskeletal protein binding
biological_process GO:0051494 - negative regulation of cytoskeleton organization
GO:0008360 - regulation of cell shape
GO:0001896 - autolysis
GO:2000245 - negative regulation of FtsZ-dependent cytokinesis
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IE] Inferred from experiment
Reference(s): [1] Brown JM., et al., 2003
[2] Tan Q., et al., 2011
External database links:  
ECOCYC:
G7085-MONOMER
ECOLIWIKI:
b2005
INTERPRO:
IPR009610
PFAM:
PF06755
PRIDE:
P64524
REFSEQ:
NP_416509
UNIPROT:
P64524


Operon      
Name: yeeRST-cbeA-cbtA-yeeW         
Operon arrangement:
Transcription unit        Promoter
yeeRST-cbeA-cbtA-yeeW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brown JM., Shaw KJ., 2003, A novel family of Escherichia coli toxin-antitoxin gene pairs., J Bacteriol 185(22):6600-8

 [2] Tan Q., Awano N., Inouye M., 2011, YeeV is an Escherichia coli toxin that inhibits cell division by targeting the cytoskeleton proteins, FtsZ and MreB., Mol Microbiol 79(1):109-18


RegulonDB