RegulonDB RegulonDB 10.9: Gene Form
   

insH7 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: insH7    Texpresso search in the literature
Synonym(s): ECK0261, G7092, b2030, trs5-7, yi52_7
Genome position(nucleotides): 2101895 <-- 2102875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0006742
ECOLIHUB:
insH-7
OU-MICROARRAY:
b2030
STRING:
511145.b3505
COLOMBOS: insH7


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH7
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4237
ECOLIWIKI:
b2030
INTERPRO:
IPR002559
INTERPRO:
IPR008490
PFAM:
PF05598
PFAM:
PF01609
PRIDE:
P0CE54
REFSEQ:
NP_416535
UNIPROT:
P0CE54


Operon      
Name: insH7         
Operon arrangement:
Transcription unit        Promoter
insH-7


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2371 2101069 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2372 (cluster) 2101178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2373 (cluster) 2101320 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2374 2101322 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2376 2101396 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2377 2101409 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2378 2101436 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2379 2102902 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2380 (cluster) 2102949 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter insHp6 2103049 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp5 2103090 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2103093 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2381 2103462 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2382 2103479 reverse nd [RS-EPT-CBR] [1]



RegulonDB