RegulonDB RegulonDB 10.9: Gene Form
   

wcaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gmd wcaE wcaF

Gene      
Name: wcaF    Texpresso search in the literature
Synonym(s): ECK2048, G7099, b2054
Genome position(nucleotides): 2128340 <-- 2128888 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.91
External database links:  
ASAP:
ABE-0006805
ECHOBASE:
EB3344
ECOLIHUB:
wcaF
OU-MICROARRAY:
b2054
STRING:
511145.b2054
COLOMBOS: wcaF


Product      
Name: colanic acid biosynthesis acetyltransferase WcaF
Synonym(s): WcaF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.962
Isoelectric point: 9.736
Motif(s):
 
Type Positions Sequence
125 -> 157 IVIGEKCWLATDVFVAPGVTIGDGTVVGARSSV
50 -> 50 F

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016413 - O-acetyltransferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0044010 - single-species biofilm formation
GO:0045228 - slime layer polysaccharide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7099-MONOMER
ECOLIWIKI:
b2054
INTERPRO:
IPR001451
INTERPRO:
IPR011004
INTERPRO:
IPR018357
INTERPRO:
IPR024005
MODBASE:
P0ACD2
PFAM:
PF00132
PRIDE:
P0ACD2
PROSITE:
PS00101
REFSEQ:
NP_416558
SMR:
P0ACD2
UNIPROT:
P0ACD2


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB