RegulonDB RegulonDB 10.8: Gene Form
   

wcaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wcaD wcaE wcaF wcaC

Gene      
Name: wcaE    Texpresso search in the literature
Synonym(s): ECK2049, G7100, b2055
Genome position(nucleotides): 2128904 <-- 2129650 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.52
External database links:  
ASAP:
ABE-0006807
ECHOBASE:
EB3343
OU-MICROARRAY:
b2055
PortEco:
wcaE
STRING:
511145.b2055
COLOMBOS: wcaE


Product      
Name: colanic acid biosynthesis fucosyltransferase WcaE
Synonym(s): WcaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.894
Isoelectric point: 9.78
Motif(s):
 
Type Positions Sequence
4 -> 98 SIITVAFRNLEGIVKTHASLAHLAQVEDISFEWIVVDGGSNDGTREYLENLNGIFNLRFVSEPDNGIYDAMNKGIAMAQGKFALFLNSGDIFHQN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0008417 - fucosyltransferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0045228 - slime layer polysaccharide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT2
DIP:
DIP-11121N
ECOCYC:
G7100-MONOMER
ECOLIWIKI:
b2055
INTERPRO:
IPR029044
INTERPRO:
IPR024010
INTERPRO:
IPR001173
MODBASE:
P71239
PFAM:
PF00535
PRIDE:
P71239
REFSEQ:
NP_416559
UNIPROT:
P71239


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB