RegulonDB RegulonDB 10.8: Gene Form
   

wcaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wcaD wcaC wcaA wcaE wcaB

Gene      
Name: wcaC    Texpresso search in the literature
Synonym(s): ECK2051, G7102, b2057
Genome position(nucleotides): 2130853 <-- 2132070 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.61
External database links:  
ASAP:
ABE-0006811
ECHOBASE:
EB3341
OU-MICROARRAY:
b2057
PortEco:
wcaC
STRING:
511145.b2057
COLOMBOS: wcaC


Product      
Name: colanic acid biosynthesis galactosyltransferase WcaC
Synonym(s): WcaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.26
Isoelectric point: 8.858
Motif(s):
 
Type Positions Sequence
13 -> 223 GGAAGVALDLHQRALQQGLASHFVYGYGKGGKESVSHQNYPQVIKHTPRMTAMANIALFRLFNRDLFGNFNELYRTITRTAGPVVLHFHVLHSYWLNLKSVVRFCEKVKNHKPDVTLVWTLHDHWSVTGRCAFTDGCEGWKTGCQKCPTLNNYPPVKIDRAHQLVAGKRQLFREMLALGCQFISPSQHVADAFNSLYGPGRCRIINNGIDM
292 -> 348 GFETDKRKLMSALNQMDALVFSSRVDNYPLILCEALSIGVPVIATHSDAAREVLQKS
232 -> 232 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0035250 - UDP-galactosyltransferase activity
GO:0016740 - transferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0045228 - slime layer polysaccharide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT4
DIP:
DIP-11119N
ECOCYC:
G7102-MONOMER
ECOLIWIKI:
b2057
INTERPRO:
IPR001296
INTERPRO:
IPR028098
INTERPRO:
IPR023916
MINT:
MINT-1255947
MODBASE:
P71237
PANTHER:
PTHR12526:SF5
PFAM:
PF00534
PFAM:
PF13439
PRIDE:
P71237
REFSEQ:
NP_416561
UNIPROT:
P71237


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB