RegulonDB RegulonDB 10.8: Gene Form
   

wzb gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzc wza wzb wzap2 wzap2

Gene      
Name: wzb    Texpresso search in the literature
Synonym(s): ECK2055, G7106, b2061
Genome position(nucleotides): 2135655 <-- 2136098 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
External database links:  
ASAP:
ABE-0006822
ECHOBASE:
EB3337
OU-MICROARRAY:
b2061
PortEco:
wzb
STRING:
511145.b2061
COLOMBOS: wzb


Product      
Name: protein-tyrosine phosphatase
Synonym(s): Wzb
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.709
Isoelectric point: 7.834
Motif(s):
 
Type Positions Sequence
5 -> 139 ILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSLEGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKSRETFAAVYTLLERSARQWA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0004725 - protein tyrosine phosphatase activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0006470 - protein dephosphorylation
GO:0035335 - peptidyl-tyrosine dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Stevenson G., et al., 1996
External database links:  
ECOCYC:
G7106-MONOMER
ECOLIWIKI:
b2061
INTERPRO:
IPR036196
INTERPRO:
IPR023485
INTERPRO:
IPR017867
MINT:
P0AAB2
MODBASE:
P0AAB2
PANTHER:
PTHR11717:SF20
PDB:
2FEK
PFAM:
PF01451
PRIDE:
P0AAB2
PRINTS:
PR00719
PRODB:
PRO_000024222
REFSEQ:
NP_416565
SMART:
SM00226
SMR:
P0AAB2
UNIPROT:
P0AAB2


Operon      
Name: wza-wzb-wzc-wcaAB         
Operon arrangement:
Transcription unit        Promoter
wzbc
wza-wzb-wzc-wcaAB


Transcriptional Regulation      
Display Regulation             
Activated by: RcsAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Stevenson G., Andrianopoulos K., Hobbs M., Reeves PR., 1996, Organization of the Escherichia coli K-12 gene cluster responsible for production of the extracellular polysaccharide colanic acid., J Bacteriol 178(16):4885-93


RegulonDB