RegulonDB RegulonDB 10.9: Gene Form
   

wza gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegH wza wzb RcsAB RcsAB Cis-reg yegHp yegHp wzap wzap wzap2 wzap2

Gene      
Name: wza    Texpresso search in the literature
Synonym(s): ECK2056, G7107, b2062
Genome position(nucleotides): 2136104 <-- 2137243 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0006825
ECHOBASE:
EB3336
ECOLIHUB:
wza
OU-MICROARRAY:
b2062
STRING:
511145.b2062
COLOMBOS: wza


Product      
Name: outer membrane polysaccharide export protein Wza
Synonym(s): Wza
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 41.91
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
21 -> 379 CTVLPGSNMSTMGKDVIKQQDADFDLDKMVNVYPLTPRLIDQLRPRPNVARPNMTLESEIANYQYRVGPGDVLNVTVWDHPELTTPAGQYRSSSDTGNWVQPDGTMFYPYIGKVHVVGKTLAEIRSDITGRLATYIADPQVDVNIAAFRSQKAYISGQVNKSGQQAITNVPLTILDAINAAGGLTDTADWRNVVLTHNGREERISLQALMQNGDLNQNRLLYPGDILYVPRNDDLKVFVMGEVKKQSTLKMDFSGMTLTEALGNAEGIDMTTSNASGIFVIRPLKGEGGRNGKIANIYQLDMSDATSLVMATEFRLQPYDVVYVTTAPVSRWNRLINQLLPTISGVRYMTDTASDIHNW
321 -> 321 D
1 -> 20 MMKSKMKLMPLLVSVTLISG
82 -> 165 NYQYRVGPGDVLNVTVWDHPELTTPAGQYRSSSDTGNWVQPDGTMFYPYIGKVHVVGKTLAEIRSDITGRLATYIADPQVDVNI
173 -> 221 AYISGQVNKSGQQAITNVPLTILDAINAAGGLTDTADWRNVVLTHNGRE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0005515 - protein binding
GO:0015288 - porin activity
GO:0015159 - polysaccharide transmembrane transporter activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0006811 - ion transport
GO:0008643 - carbohydrate transport
GO:0046377 - colanic acid metabolic process
GO:0015774 - polysaccharide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Ford RC., et al., 2009
External database links:  
DIP:
DIP-11134N
ECOCYC:
G7107-MONOMER
ECOLIWIKI:
b2062
INTERPRO:
IPR019554
INTERPRO:
IPR040716
INTERPRO:
IPR003715
PFAM:
PF18412
PFAM:
PF02563
PFAM:
PF10531
PRIDE:
P0A930
PROSITE:
PS51257
REFSEQ:
NP_416566
SMR:
P0A930
UNIPROT:
P0A930


Operon      
Name: wza-wzb-wzc-wcaAB         
Operon arrangement:
Transcription unit        Promoter
wzbc
wza-wzb-wzc-wcaAB


Transcriptional Regulation      
Display Regulation             
Activated by: RcsAB


RNA cis-regulatory element    
   
Cis-reg JUMPstart RNA
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ford RC., Brunkan-LaMontagne AL., Collins RF., Clarke BR., Harris R., Naismith JH., Whitfield C., 2009, Structure-function relationships of the outer membrane translocon Wza investigated by cryo-electron microscopy and mutagenesis., J Struct Biol 166(2):172-82


RegulonDB