RegulonDB RegulonDB 10.8: Gene Form
   

yegH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

asmA yegH wza RcsAB RcsAB Cis-reg TSS_2401 TSS_2401 TSS_2400 TSS_2400 TSS_2399 TSS_2399 yegHp yegHp wzap wzap wzap2 wzap2

Gene      
Name: yegH    Texpresso search in the literature
Synonym(s): ECK2057, G7108, b2063
Genome position(nucleotides): 2137902 --> 2139485 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.16
External database links:  
ASAP:
ABE-0006830
ECHOBASE:
EB3804
OU-MICROARRAY:
b2063
PortEco:
yegH
STRING:
511145.b2063
COLOMBOS: yegH


Product      
Name: inner membrane protein YegH
Synonym(s): YegH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.45
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
372 -> 422 IRQPLVFPETLPLLPALEQFRNARTHFAFVVDEFGSVEGIVTLSDVTETIA
440 -> 516 KNADGSWTANGHMPLEDLVQYVPLPLDEKREYHTIAGLLMEYLQRIPKPGEEVQVGDYLLKTLQVESHRVQKVQIIP
14 -> 34 ITLIVIELVLGIDNLVFIAIL
302 -> 358 VSSIMTSRHDIEHIDLNAPEEEIRQLLERNQHTRLVVTDGDDAEDLLGVVHVIDLLQ
145 -> 165 ITAVGMVDHLLVMMAAVVIAI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0050660 - flavin adenine dinucleotide binding
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11879N
ECOCYC:
G7108-MONOMER
ECOLIWIKI:
b2063
INTERPRO:
IPR005496
INTERPRO:
IPR005170
INTERPRO:
IPR016169
INTERPRO:
IPR036318
INTERPRO:
IPR000644
MODBASE:
P76389
PFAM:
PF03471
PFAM:
PF03741
PFAM:
PF00571
PRIDE:
P76389
PROSITE:
PS51371
REFSEQ:
NP_416567
SMART:
SM01091
SMART:
SM00116
SMR:
P76389
UNIPROT:
P76389


Operon      
Name: yegH         
Operon arrangement:
Transcription unit        Promoter
yegH


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2399 2140025 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2400 2140792 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2401 2140838 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB