RegulonDB RegulonDB 10.9: Gene Form
   

mdtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtB mdtC mdtA sibB ibsB BaeR CpxR CpxR SibB mdtAp mdtAp

Gene      
Name: mdtA    Texpresso search in the literature
Synonym(s): ECK2070, G7113, b2074, yegM
Genome position(nucleotides): 2154016 --> 2155263 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.29
External database links:  
ASAP:
ABE-0006872
ECHOBASE:
EB3809
ECOLIHUB:
mdtA
OU-MICROARRAY:
b2074
STRING:
511145.b2074
COLOMBOS: mdtA


Product      
Name: multidrug efflux pump membrane fusion protein MdtA
Synonym(s): MdtA, MdtA membrane fusion protein, YegM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 44.464
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
1 -> 21 MKGSYKSRWVIVIVVVIAAIA
22 -> 415 AFWFWQGRNDSRSAAPGATKQAQQSPAGGRRGMRSGPLAPVQAATAVEQAVPRYLTGLGTITAANTVTVRSRVDGQLIALHFQEGQQVKAGDLLAEIDPSQFKVALAQAQGQLAKDKATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIKADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTLPESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQDDALFPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNSENKVSKHLVTPGIQDSQKVVIRAGISAGDRVVTDGIDRLTEGAKVEVVEAQSATTPEEKATSREYAKKGARS
198 -> 301 ITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTLPESDIATVVQAQKAGKPLVVEAWDRTNSKKLSEGTLLSLDNQIDATTGTIKVKARFNNQDD
87 -> 135 TVTVRSRVDGQLIALHFQEGQQVKAGDLLAEIDPSQFKVALAQAQGQLA
6 -> 27 KSRWVIVIVVVIAAIAAFWFWQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0015562 - efflux transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0042908 - xenobiotic transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
MDTA
ECOLIWIKI:
b2074
INTERPRO:
IPR006143
INTERPRO:
IPR022824
INTERPRO:
IPR039562
MODBASE:
P76397
PFAM:
PF13533
PFAM:
PF13437
PRIDE:
P76397
PRODB:
PRO_000023182
REFSEQ:
NP_416578
SMR:
P76397
UNIPROT:
P76397


Operon      
Name: mdtABCD-baeSR         
Operon arrangement:
Transcription unit        Promoter
mdtABCD-baeSR
baeSR


Transcriptional Regulation      
Display Regulation             
Activated by: BaeR, CpxR
Growth Conditions:

[1] 

C: Escherichia coli| plasmid pBAD/Myc-HisA mutant| LB medium| 37.0 C| mid exponential phase
E: Escherichia coli| plasmid pBADBaeR (arabinose-induced baeR) mutant| LB medium| 37.0 C| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB