RegulonDB RegulonDB 10.8: Gene Form
   

yeiS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

preT sanA yeiS preA CRP TSS_2455 TSS_2455 preTp preTp

Gene      
Name: yeiS    Texpresso search in the literature
Synonym(s): ECK2138, G7144, b2145
Genome position(nucleotides): 2233600 --> 2233839 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.92
External database links:  
ASAP:
ABE-0007093
ECHOBASE:
EB3826
OU-MICROARRAY:
b2145
PortEco:
yeiS
STRING:
511145.b2145
COLOMBOS: yeiS


Product      
Name: DUF2542 domain-containing protein YeiS
Synonym(s): YeiS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 9.264
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
1 -> 79 MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVAYIGFGILSIGMIVYLIFYR
53 -> 73 LFFAYMVAYIGFGILSIGMIV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7144-MONOMER
ECOLIWIKI:
b2145
INTERPRO:
IPR020155
PFAM:
PF10808
PRIDE:
P64536
PRODOM:
PD058881
REFSEQ:
NP_416650
UNIPROT:
P64536


Operon      
Name: sanA-yeiS         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2455 2234353 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB