RegulonDB RegulonDB 11.0: Gene Form
   

mepS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeN lpxT mepS terminator anti-terminator anti-anti-terminator rtnp1 rtnp1 TSS_2474 TSS_2474 mepSp1 mepSp1 mepSp2 mepSp2

Gene      
Name: mepS    Texpresso search in the literature
Synonym(s): ECK2169, G7147, b2175, spr, yeiV
Genome position(nucleotides): 2269979 --> 2270545
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.74
External database links:  
ASAP:
ABE-0007200
ECHOBASE:
EB3829
ECOLIHUB:
spr
OU-MICROARRAY:
b2175
STRING:
511145.b2175
COLOMBOS: mepS


Product      
Name: peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase
Synonym(s): MepS, Spr, YeiV
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 21.04
Isoelectric point: 10.482
Motif(s):
 
Type Positions Sequence Comment
1 -> 26 MVKSQPILRYILRGIPAIAVAVLLSA
27 -> 188 CSANNTAKNMHPETRAVGSETSSLQASQDEFENLVRNVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEMGKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNEARRVLSRS UniProt: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase.
64 -> 185 VDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEMGKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNEARRVL UniProt: NlpC/P60.
66 -> 77 VKSRIMDQYADW
79 -> 183 GVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEMGKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNEARR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0106415 - muramoyltetrapeptide carboxypeptidase activity
GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0008234 - cysteine-type peptidase activity
GO:0004175 - endopeptidase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0006508 - proteolysis
GO:0009254 - peptidoglycan turnover
GO:0045227 - capsule polysaccharide biosynthetic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Hara H., et al., 1996
[2] Rao S., et al., 2020
External database links:  
ALPHAFOLD:
P0AFV4
ECOCYC:
G7147-MONOMER
ECOLIWIKI:
b2175
INTERPRO:
IPR000064
INTERPRO:
IPR038765
PDB:
2K1G
PFAM:
PF00877
PRIDE:
P0AFV4
PRODB:
PRO_000023979
PROSITE:
PS51257
REFSEQ:
NP_416680
SMR:
P0AFV4
UNIPROT:
P0AFV4


Operon      
Name: mepS         
Operon arrangement:
Transcription unit        Promoter
mepS
mepS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2474 2269943 forward nd [RS-EPT-CBR] [3]
  promoter rtnp1 2270678 forward nd [ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hara H., Abe N., Nakakouji M., Nishimura Y., Horiuchi K., 1996, Overproduction of penicillin-binding protein 7 suppresses thermosensitive growth defect at low osmolarity due to an spr mutation of Escherichia coli., Microb Drug Resist 2(1):63-72

 [2] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB