RegulonDB RegulonDB 10.9: Gene Form
   

insH8 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH8 narP b2191 proL narPp narPp TSS_2483 TSS_2483 yejOp yejOp

Gene      
Name: insH8    Texpresso search in the literature
Synonym(s): ECK0261, G7150, b2192, trs5-8, yi52_8
Genome position(nucleotides): 2289065 <-- 2290045 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0007252
ECOLIHUB:
insH-8
OU-MICROARRAY:
b2192
STRING:
511145.b3505
COLOMBOS: insH8


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH8
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4238
ECOLIWIKI:
b2192
INTERPRO:
IPR002559
INTERPRO:
IPR008490
PFAM:
PF05598
PFAM:
PF01609
PRIDE:
P0CE55
REFSEQ:
NP_416696
UNIPROT:
P0CE55


Operon      
Name: insH8         
Operon arrangement:
Transcription unit        Promoter
insH-8


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2483 2290072 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB