RegulonDB RegulonDB 10.9: Gene Form
   

yfaQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaS yfaQ yfaP yfaT yfaA yfaPp4 yfaPp4

Gene      
Name: yfaQ    Texpresso search in the literature
Synonym(s): ECK2219, G7153, b2226
Genome position(nucleotides): 2328148 <-- 2329797 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.61
External database links:  
ASAP:
ABE-0007359
ECHOBASE:
EB3832
ECOLIHUB:
yfaQ
ECOO157CYC:
Z3479
ECOO157CYC:
Z3480
OU-MICROARRAY:
b2226
STRING:
511145.b2226
COLOMBOS: yfaQ


Product      
Name: tandem DUF2300 domain-containing protein YfaQ
Synonym(s): YfaQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 61.476
Isoelectric point: 8.361
Motif(s):
 
Type Positions Sequence
412 -> 531 GTLSWRQATAQAGQGERYDQILAFAYPDNSLSRWGAPRSTCQLLPKAKAWLAKKMPQWRRILQAETGYNEPDVFAVCRLVSGFPYTDRQQKRLFIRNFFTLQDRLDLTHEYLHLAFDGYP
84 -> 205 GNSPEEVYCCQAGESITRDTALVRSCGLYFAPQRLHIGADVWGQYWQQRQAPAWLASLTTLKPETSVTVKSLLDSLATLPAQNKAQEVLLDVVLDEAKIGVASMLGSRVRVKTWSWFADDKQ
312 -> 375 KGKLKLQSHLDREEYVARVLDREAKSTPPEAAKAMTVAIRTFLQQNANREGDCLTIPDSSATQR
20 -> 549 EETPLQLVLRGAQHDQLYQLSSSGVTKVSALPDSLTTPLGSLWKLYVYAWLEDTHQPEQPYQCRGNSPEEVYCCQAGESITRDTALVRSCGLYFAPQRLHIGADVWGQYWQQRQAPAWLASLTTLKPETSVTVKSLLDSLATLPAQNKAQEVLLDVVLDEAKIGVASMLGSRVRVKTWSWFADDKQEIRQGGFAGWLTDGTPLWVTGSGTSKTVLTRYATVLNRVLPVPTQVASGQCVEVELFARYPLKKITAEKSTTAVNPGVLNGRYRVTFTNGNHITFVSHGETTLLSEKGKLKLQSHLDREEYVARVLDREAKSTPPEAAKAMTVAIRTFLQQNANREGDCLTIPDSSATQRVSASPATTGARTMTAWTQDLIYAGDPVHYHGSRATEGTLSWRQATAQAGQGERYDQILAFAYPDNSLSRWGAPRSTCQLLPKAKAWLAKKMPQWRRILQAETGYNEPDVFAVCRLVSGFPYTDRQQKRLFIRNFFTLQDRLDLTHEYLHLAFDGYPTGLDENYIETLTRQLLMD
1 -> 19 MNWRRIVWLLALVTLPTLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7153-MONOMER
ECOLIWIKI:
b2226
ECOO157CYC:
Z3479-MONOMER
ECOO157CYC:
Z3480-MONOMER
INTERPRO:
IPR012338
INTERPRO:
IPR018748
INTERPRO:
IPR013693
PFAM:
PF10062
PFAM:
PF08486
PRIDE:
P76463
REFSEQ:
NP_416730
UNIPROT:
P76463


Operon      
Name: yfaATSQP         
Operon arrangement:
Transcription unit        Promoter
yfaATSQP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaPp4 2328199 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB