RegulonDB RegulonDB 10.9: Gene Form
   

rhmD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaV rhmD yfaX terminator rhmAp3 rhmAp3

Gene      
Name: rhmD    Texpresso search in the literature
Synonym(s): ECK2240, G7160, b2247, yfaW
Genome position(nucleotides): 2360209 <-- 2361414 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.16
External database links:  
ASAP:
ABE-0007436
ECHOBASE:
EB3838
ECOLIHUB:
yfaW
OU-MICROARRAY:
b2247
STRING:
511145.b2247
COLOMBOS: rhmD


Product      
Name: L-rhamnonate dehydratase
Synonym(s): RhmD, YfaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.226
Isoelectric point: 6.224
Motif(s):
 
Type Positions Sequence
67 -> 157 VVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQMLSATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLG
180 -> 392 GFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGEDFWLMLDCWMSQDVNYATKLAHACAPYNLKWIEECLPPQQYESYRELKRNAPVGMMVTSGEHHGTLQSFRTLSETGIDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNRD
277 -> 277 H
29 -> 29 H
325 -> 325 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016836 - hydro-lyase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0050032 - L-rhamnonate dehydratase activity
biological_process GO:0009063 - cellular amino acid catabolic process
GO:0016052 - carbohydrate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11955N
ECOCYC:
G7160-MONOMER
ECOLIWIKI:
b2247
INTERPRO:
IPR023444
INTERPRO:
IPR036849
INTERPRO:
IPR029065
INTERPRO:
IPR029017
INTERPRO:
IPR018110
INTERPRO:
IPR013342
INTERPRO:
IPR013341
MODBASE:
P77215
PANTHER:
PTHR13794:SF59
PDB:
2I5Q
PFAM:
PF02746
PFAM:
PF13378
PRIDE:
P77215
PROSITE:
PS00908
REFSEQ:
NP_416750
SMART:
SM00922
SMR:
P77215
UNIPROT:
P77215


Operon      
Name: yfaX-rhmD-yfaVU         
Operon arrangement:
Transcription unit        Promoter
yfaVU
yfaX-rhmD
yfaXWVU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rhmAp3 2358946 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB