RegulonDB RegulonDB 10.9: Gene Form
   

yfaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhmD yfaY yfaX terminator

Gene      
Name: yfaX    Texpresso search in the literature
Synonym(s): ECK2241, G7161, b2248
Genome position(nucleotides): 2361429 <-- 2362211 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.96
External database links:  
ASAP:
ABE-0007438
ECHOBASE:
EB3839
ECOLIHUB:
yfaX
OU-MICROARRAY:
b2248
STRING:
511145.b2248
COLOMBOS: yfaX


Product      
Name: putative DNA-binding transcriptional regulator YfaX
Synonym(s): YfaX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.904
Isoelectric point: 7.468
Motif(s):
 
Type Positions Sequence
9 -> 58 ALTRAIDILNLIARIGPCSAATIIDTLGIPKSTAYLLLNELRRQRFLSLD
7 -> 67 VPALTRAIDILNLIARIGPCSAATIIDTLGIPKSTAYLLLNELRRQRFLSLDHQENFCLWT
28 -> 47 AATIIDTLGIPKSTAYLLLN
82 -> 251 LRELARPRLTQLMDTTGLLCHLGIIDNGSAYYILKVESSATISVRSHEGKSLSLYRSGIGKCLLAWQPAAVQQSIIEGLVWEQATPTTITHPQQLHEELARIRRQGWSYDNGEDYADVRCVAAPVFNANNELTAAISVVGTRLQINEEYRDYLAGKAIACARDISRLLGW
122 -> 247 TISVRSHEGKSLSLYRSGIGKCLLAWQPAAVQQSIIEGLVWEQATPTTITHPQQLHEELARIRRQGWSYDNGEDYADVRCVAAPVFNANNELTAAISVVGTRLQINEEYRDYLAGKAIACARDISR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11956N
ECOCYC:
G7161-MONOMER
ECOLIWIKI:
b2248
INTERPRO:
IPR036390
INTERPRO:
IPR029016
INTERPRO:
IPR014757
INTERPRO:
IPR005471
INTERPRO:
IPR036388
MODBASE:
P77732
PFAM:
PF09339
PFAM:
PF01614
PRIDE:
P77732
PROSITE:
PS51078
PROSITE:
PS51077
REFSEQ:
NP_416751
SMART:
SM00346
SMR:
P77732
UNIPROT:
P77732


Operon      
Name: yfaX-rhmD-yfaVU         
Operon arrangement:
Transcription unit        Promoter
yfaVU
yfaX-rhmD
yfaXWVU


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB