RegulonDB RegulonDB 10.9: Gene Form
   

arnC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arnA arnB arnC arnD TSS_2518 TSS_2518 TSS_2517 TSS_2517

Gene      
Name: arnC    Texpresso search in the literature
Synonym(s): ECK2247, G7167, b2254, pmrF, yfbF
Genome position(nucleotides): 2367071 --> 2368039 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.85
External database links:  
ASAP:
ABE-0007458
ECHOBASE:
EB3843
ECOLIHUB:
arnC
MIM:
608799
OU-MICROARRAY:
b2254
STRING:
511145.b2254
COLOMBOS: arnC


Product      
Name: undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
Synonym(s): ArnC, PmrF, YfbF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 36.339
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
11 -> 171 SVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVEASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEGYDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIV
270 -> 290 VFMLFAVLFTFIGAQFIGMGL
236 -> 256 LSLLGSIIAIGGFSIAVLLVI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0099621 - undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0046677 - response to antibiotic
GO:0036108 - 4-amino-4-deoxy-alpha-L-arabinopyranosyl undecaprenyl phosphate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT2
ECOCYC:
G7167-MONOMER
ECOLIWIKI:
b2254
INTERPRO:
IPR001173
INTERPRO:
IPR029044
INTERPRO:
IPR022857
MODBASE:
P77757
PFAM:
PF00535
PRIDE:
P77757
PRODB:
PRO_000022140
REFSEQ:
NP_416757
UNIPROT:
P77757


Operon      
Name: arnBCADTEF         
Operon arrangement:
Transcription unit        Promoter
arnBCADTEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2517 2367228 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2518 2369128 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB