RegulonDB RegulonDB 10.9: Gene Form
   

arnA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arnA arnT arnB arnC arnD arnE TSS_2518 TSS_2518 TSS_2517 TSS_2517

Gene      
Name: arnA    Texpresso search in the literature
Synonym(s): ECK2248, G7168, SAF, b2255, pmrI, yfbG
Genome position(nucleotides): 2368039 --> 2370021 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.13
External database links:  
ASAP:
ABE-0007460
ECHOBASE:
EB3844
ECOLIHUB:
arnA
OU-MICROARRAY:
b2255
STRING:
511145.b2255
COLOMBOS: arnA


Product      
Name: fused UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronate dehydrogenase
Synonym(s): ArnA, PmrI, YfbG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 74.289
Isoelectric point: 6.868
Motif(s):
 
Type Positions Sequence
433 -> 433 S
1 -> 304 MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDNPGEKAFYGSVARLAAERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGRRTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPHASKAQPGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQGSRL
318 -> 566 VLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIG
368 -> 369 DI
434 -> 434 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016742 - hydroxymethyl-, formyl- and related transferase activity
GO:0042802 - identical protein binding
GO:0070403 - NAD+ binding
GO:0048040 - UDP-glucuronate decarboxylase activity
GO:0099618 - UDP-glucuronic acid dehydrogenase activity
GO:0099619 - UDP-4-amino-4-deoxy-L-arabinose formyltransferase activity
biological_process GO:0008152 - metabolic process
GO:0006629 - lipid metabolic process
GO:0009058 - biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0046493 - lipid A metabolic process
GO:0046677 - response to antibiotic
GO:0055114 - oxidation-reduction process
GO:0033320 - UDP-D-xylose biosynthetic process
GO:2001315 - UDP-4-deoxy-4-formamido-beta-L-arabinopyranose biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Andersen KR., et al., 2013
[2] Robichon C., et al., 2011
[3] Saulou-Berion C., et al., 2015
[4] Zhou Z., et al., 1999
External database links:  
DIP:
DIP-11961N
ECOCYC:
G7168-MONOMER
ECOLIWIKI:
b2255
INTERPRO:
IPR001509
INTERPRO:
IPR036477
INTERPRO:
IPR036291
INTERPRO:
IPR002376
INTERPRO:
IPR005793
INTERPRO:
IPR011034
INTERPRO:
IPR021168
MODBASE:
P77398
PDB:
1U9J
PDB:
6PIK
PDB:
6PIH
PDB:
4WKG
PDB:
1YRW
PDB:
1Z73
PDB:
1Z74
PDB:
1Z75
PDB:
1Z7B
PDB:
1Z7E
PDB:
2BLL
PDB:
2BLN
PFAM:
PF01370
PFAM:
PF00551
PFAM:
PF02911
PRIDE:
P77398
PRODB:
PRO_000022138
REFSEQ:
NP_416758
SMR:
P77398
UNIPROT:
P77398


Operon      
Name: arnBCADTEF         
Operon arrangement:
Transcription unit        Promoter
arnBCADTEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2517 2367228 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2518 2369128 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Andersen KR., Leksa NC., Schwartz TU., 2013, Optimized E. coli expression strain LOBSTR eliminates common contaminants from His-tag purification., Proteins 81(11):1857-61

 [2] Robichon C., Luo J., Causey TB., Benner JS., Samuelson JC., 2011, Engineering Escherichia coli BL21(DE3) derivative strains to minimize E. coli protein contamination after purification by immobilized metal affinity chromatography., Appl Environ Microbiol 77(13):4634-46

 [3] Saulou-Berion C., Gonzalez I., Enjalbert B., Audinot JN., Fourquaux I., Jamme F., Cocaign-Bousquet M., Mercier-Bonin M., Girbal L., 2015, Escherichia coli under Ionic Silver Stress: An Integrative Approach to Explore Transcriptional, Physiological and Biochemical Responses., PLoS One 10(12):e0145748

 [4] Zhou Z., Lin S., Cotter RJ., Raetz CR., 1999, Lipid A modifications characteristic of Salmonella typhimurium are induced by NH4VO3 in Escherichia coli K12. Detection of 4-amino-4-deoxy-L-arabinose, phosphoethanolamine and palmitate., J Biol Chem 274(26):18503-14

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB