RegulonDB RegulonDB 10.9: Gene Form
   

pmrD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menE arnF arnE pmrD arnT menC pmrDp3 pmrDp3 pmrDp4 pmrDp4

Gene      
Name: pmrD    Texpresso search in the literature
Synonym(s): ECK2253, G7172, b2259
Genome position(nucleotides): 2373272 <-- 2373538 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.82
External database links:  
ASAP:
ABE-0007468
ECHOBASE:
EB2537
ECOLIHUB:
pmrD
OU-MICROARRAY:
b2259
STRING:
511145.b2259
COLOMBOS: pmrD


Product      
Name: signal transduction protein PmrD
Synonym(s): PmrD, polymyxin B resistance protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.87
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
82 -> 82 K
1 -> 82 MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCK
20 -> 20 M
88 -> 88 Q
19 -> 19 L

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Herrera CM., et al., 2010
[2] Jo H., et al., 2014
External database links:  
ECOCYC:
G7172-MONOMER
ECOLIWIKI:
b2259
INTERPRO:
IPR038679
PDB:
2JSO
PDB:
4HN7
PFAM:
PF11183
PRIDE:
P37590
PRODB:
PRO_000023559
REFSEQ:
NP_416762
SMR:
P37590
UNIPROT:
P37590


Operon      
Name: pmrD         
Operon arrangement:
Transcription unit        Promoter
pmrD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pmrDp4 2373566 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter pmrDp3 2373574 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Herrera CM., Hankins JV., Trent MS., 2010, Activation of PmrA inhibits LpxT-dependent phosphorylation of lipid A promoting resistance to antimicrobial peptides., Mol Microbiol 76(6):1444-60

 [2] Jo H., Jeong E., Jeon J., Ban C., 2014, Structural insights into Escherichia coli polymyxin B resistance protein D with X-ray crystallography and small-angle X-ray scattering., BMC Struct Biol 14(1):24

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB