RegulonDB RegulonDB 11.0: Gene Form
   

yfbK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfbK elaD yfbL yfbKp7 yfbKp7 yfbLp7 yfbLp7 yfbLp10 yfbLp10 yfbKp3 yfbKp3 yfbLp9 yfbLp9 yfbLp3 yfbLp3 yfbLp5 yfbLp5 TSS_2529 TSS_2529

Gene      
Name: yfbK    Texpresso search in the literature
Synonym(s): ECK2264, G7177, b2270
Genome position(nucleotides): 2383995 <-- 2385722
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.22
External database links:  
ASAP:
ABE-0007501
ECHOBASE:
EB3848
ECOLIHUB:
yfbK
OU-MICROARRAY:
b2270
STRING:
511145.b2270
COLOMBOS: yfbK


Product      
Name: IPR002035/DUF3520 domain-containing protein YfbK
Synonym(s): YfbK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 63.634
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence Comment
19 -> 42 CGPQPENKESQQQQPSTPTEQQVL UniProt: Disordered; Sequence Annotation Type: region of interest.
101 -> 199 GTARYQQFDDNPVKQVAQNPLATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDWDIKDKQSIPASKPIPFAMRYELAPAPWNEQRTLLK
216 -> 384 NLVFLIDTSGSMISDERLPLIQSSLKLLVKELREQDNIAIVTYAGDSRIALPSISGSHKAEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINRILLATDGDFNVGIDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDTLSEAQK
393 -> 568 MLITVAKDVKAQIEFNPAWVTEYRQIGYEKRQLRVEHFNNDNVDAGDIGAGKHITLLFELTLNGQKASIDKLRYAPDNKLAKSDKTKELAWLKIRWKYPQGKESQLVEFPLGPTINAPSEDMRFRAAVAAYGQKLRGSEYLNNTSWQQIKQWAQQAKGEDPQGYRAEFIRLIELAD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Rao S., et al., 2020
External database links:  
ALPHAFOLD:
P76481
ECOCYC:
G7177-MONOMER
ECOLIWIKI:
b2270
INTERPRO:
IPR022156
INTERPRO:
IPR036465
INTERPRO:
IPR021908
INTERPRO:
IPR002035
MODBASE:
P76481
PFAM:
PF00092
PFAM:
PF12034
PFAM:
PF12450
PRIDE:
P76481
PROSITE:
PS50234
PROSITE:
PS51257
REFSEQ:
NP_416773
SMART:
SM00327
SMR:
P76481
UNIPROT:
P76481


Operon      
Name: yfbK         
Operon arrangement:
Transcription unit        Promoter
yfbK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2529 2385404 forward nd [RS-EPT-CBR] [2]
  promoter yfbLp5 2385750 forward nd [ICWHO] [3]
  promoter yfbLp3 2385760 forward nd [ICWHO] [3]
  promoter yfbLp9 2385769 forward nd [ICWHO] [3]
  promoter yfbKp3 2385784 reverse nd [ICWHO] [3]
  promoter yfbLp10 2385805 forward nd [ICWHO] [3]
  promoter yfbLp7 2385828 forward nd [ICWHO] [3]
  promoter yfbKp7 2385905 reverse nd [ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB