RegulonDB RegulonDB 10.9: Gene Form
   

yfbL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfbK yfbL yfbM yfbKp7 yfbKp7 yfbLp7 yfbLp7 yfbLp10 yfbLp10 yfbKp3 yfbKp3 yfbLp9 yfbLp9 yfbLp3 yfbLp3 yfbLp5 yfbLp5 TSS_2529 TSS_2529

Gene      
Name: yfbL    Texpresso search in the literature
Synonym(s): ECK2265, G7178, b2271
Genome position(nucleotides): 2385860 --> 2386831 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.06
External database links:  
ASAP:
ABE-0007506
ECHOBASE:
EB3849
ECOLIHUB:
yfbL
ECOO157CYC:
Z3531
OU-MICROARRAY:
b2271
STRING:
511145.b2271
COLOMBOS: yfbL


Product      
Name: putative peptidase YfbL
Synonym(s): YfbL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 35.931
Isoelectric point: 5.308
Motif(s):
 
Type Positions Sequence
4 -> 24 IIFAFIILFVFLLPMIIFYQP
95 -> 317 NIVADYGPADGPLIIIGAHYDSASSYENDQLTYTPGADDNASGVAGLLELARLLHQQVPKTGVQLVAYASEEPPFFRSDEMGSAVHAASLERPVKLMIALEMIGYYDSAPGSQNYPYPAMSWLYPDRGDFIAVVGRIQDINAVRQVKAALLSSQDLSVYSMNTPGFIPGIDFSDHLNYWQHDIPAIMITDTAFYRNKQYHLPGDTADRLNYQKMAQVVDGVIT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7178-MONOMER
ECOLIWIKI:
b2271
ECOO157CYC:
Z3531-MONOMER
INTERPRO:
IPR007484
MODBASE:
P76482
PFAM:
PF04389
PRIDE:
P76482
REFSEQ:
NP_416774
UNIPROT:
P76482


Operon      
Name: yfbL         
Operon arrangement:
Transcription unit        Promoter
yfbL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2529 2385404 forward nd [RS-EPT-CBR] [1]
  promoter yfbLp5 2385750 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp3 2385760 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp9 2385769 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbKp3 2385784 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp10 2385805 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbLp7 2385828 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfbKp7 2385905 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB