RegulonDB RegulonDB 10.9: Gene Form
   

yfbV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ackA yfbU yfbV anti-terminator terminator ptap ptap TSS_2602 TSS_2602 TSS_2601 TSS_2601 TSS_2600 TSS_2600 TSS_2599 TSS_2599 TSS_2598 TSS_2598 TSS_2597 TSS_2597 TSS_2596 TSS_2596 TSS_2595 TSS_2595 TSS_2594 TSS_2594 TSS_2593 TSS_2593 TSS_2592 (cluster) TSS_2592 (cluster) ackAp ackAp TSS_2591 (cluster) TSS_2591 (cluster) TSS_2590 (cluster) TSS_2590 (cluster) TSS_2589 (cluster) TSS_2589 (cluster) TSS_2588 (cluster) TSS_2588 (cluster) TSS_2587 (cluster) TSS_2587 (cluster) TSS_2586 TSS_2586 TSS_2585 TSS_2585 TSS_2584 TSS_2584 TSS_2583 TSS_2583 TSS_2582 (cluster) TSS_2582 (cluster) yfbUp yfbUp TSS_2581 TSS_2581

Gene      
Name: yfbV    Texpresso search in the literature
Synonym(s): ECK2289, G7189, b2295
Genome position(nucleotides): 2412677 <-- 2413132 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.88
External database links:  
ASAP:
ABE-0007575
ECHOBASE:
EB3859
ECOLIHUB:
yfbV
OU-MICROARRAY:
b2295
STRING:
511145.b2295
COLOMBOS: yfbV


Product      
Name: UPF0208 membrane protein YfbV
Synonym(s): YfbV, protein involved in regulation of chromosome structure
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.213
Isoelectric point: 10.511
Motif(s):
 
Type Positions Sequence
11 -> 149 FFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLD
46 -> 65 YAIRFMPPIAVFTLCWQIAL
69 -> 91 LGPAVATALFALSLPMQGLWWLG

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:2001251 - negative regulation of chromosome organization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7189-MONOMER
ECOLIWIKI:
b2295
INTERPRO:
IPR007334
PFAM:
PF04217
PRIDE:
P0A8D9
REFSEQ:
NP_416798
UNIPROT:
P0A8D9


Operon      
Name: yfbV         
Operon arrangement:
Transcription unit        Promoter
yfbV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2581 2412114 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2582 (cluster) 2412636 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2583 2412645 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2584 2412647 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2585 2412788 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2586 2413305 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2587 (cluster) 2413344 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2588 (cluster) 2413425 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2589 (cluster) 2413437 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2590 (cluster) 2413451 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2591 (cluster) 2413455 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2592 (cluster) 2413462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2593 2413470 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2594 2413474 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2595 2413477 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2596 2413482 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2597 2413792 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2598 2413797 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2599 2413805 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2600 2413957 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2601 2414269 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2602 2414360 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB