RegulonDB RegulonDB 10.9: Gene Form
   

yfcF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcG yfcF yfcE

Gene      
Name: yfcF    Texpresso search in the literature
Synonym(s): ECK2295, G7193, b2301
Genome position(nucleotides): 2419841 <-- 2420485 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.63
External database links:  
ASAP:
ABE-0007593
ECHOBASE:
EB3862
ECOLIHUB:
yfcF
OU-MICROARRAY:
b2301
STRING:
511145.b2301
COLOMBOS: yfcF


Product      
Name: glutathione S-transferase YfcF
Synonym(s): YfcF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.326
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
6 -> 87 ITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVPLLQIDDFELSESSAIAEYLEDRFAPPT
13 -> 80 HFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVPLLQIDDFELSESSAIAEYLE
16 -> 16 S
95 -> 211 DLENRARARQIQAWLRSDLMPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNLFGEWCIADTDLALMINRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAK
10 -> 10 S

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016034 - maleylacetoacetate isomerase activity
GO:0016740 - transferase activity
GO:0016491 - oxidoreductase activity
GO:0004364 - glutathione transferase activity
GO:0004601 - peroxidase activity
biological_process GO:0006749 - glutathione metabolic process
GO:0042542 - response to hydrogen peroxide
GO:0055114 - oxidation-reduction process
GO:0006559 - L-phenylalanine catabolic process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7193-MONOMER
ECOLIWIKI:
b2301
INTERPRO:
IPR040079
INTERPRO:
IPR036282
INTERPRO:
IPR034338
INTERPRO:
IPR036249
INTERPRO:
IPR004045
INTERPRO:
IPR010987
MODBASE:
P77544
PDB:
3BBY
PFAM:
PF14834
PFAM:
PF02798
PRIDE:
P77544
PROSITE:
PS50405
PROSITE:
PS50404
REFSEQ:
NP_416804
SMR:
P77544
UNIPROT:
P77544


Operon      
Name: yfcF         
Operon arrangement:
Transcription unit        Promoter
yfcF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB