RegulonDB RegulonDB 10.9: Gene Form
   

smrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prmB yfcO smrB TSS_2651 TSS_2651 TSS_2650 TSS_2650 smrBp4 smrBp4 TSS_2649 TSS_2649 smrBp6 smrBp6 TSS_2648 TSS_2648 TSS_2647 (cluster) TSS_2647 (cluster) TSS_2646 TSS_2646

Gene      
Name: smrB    Texpresso search in the literature
Synonym(s): ECK2325, G7202, b2331, yfcN
Genome position(nucleotides): 2448606 --> 2449157 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0007698
ECHOBASE:
EB3870
ECOLIHUB:
yfcN
OU-MICROARRAY:
b2331
STRING:
511145.b2331
COLOMBOS: smrB


Product      
Name: putative endonuclease SmrB
Synonym(s): SmrB, YfcN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.013
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
98 -> 172 LDLHGLTQLQAKQELGALIAACRREHVFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYGGDAALLVLI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48186N
ECOCYC:
G7202-MONOMER
ECOLIWIKI:
b2331
INTERPRO:
IPR002625
INTERPRO:
IPR022990
INTERPRO:
IPR036063
PFAM:
PF01713
PRIDE:
P0A8B2
PROSITE:
PS50828
REFSEQ:
NP_416834
SMART:
SM00463
SMR:
P0A8B2
UNIPROT:
P0A8B2


Operon      
Name: smrB         
Operon arrangement:
Transcription unit        Promoter
smrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2646 2447511 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2647 (cluster) 2447630 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2648 2448132 reverse nd [RS-EPT-CBR] [1]
  promoter smrBp6 2448436 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2649 2448473 reverse nd [RS-EPT-CBR] [1]
  promoter smrBp4 2448568 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2650 2448581 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2651 2449437 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB