RegulonDB RegulonDB 10.9: Gene Form
   

yfdM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfdL yfdN yfdK yfdO yfdM tfaS

Gene      
Name: yfdM    Texpresso search in the literature
Synonym(s): ECK2350, G7225, b2356, yzyB
Genome position(nucleotides): 2472112 <-- 2472387 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.54
External database links:  
ASAP:
ABE-0007775
ECHOBASE:
EB2784
ECOLIHUB:
yfdM
ECOO157CYC:
Z1454
ECOO157CYC:
Z3349
OU-MICROARRAY:
b2356
STRING:
316407.85675370
COLOMBOS: yfdM


Product      
Name: CPS-53 (KpLE1) prophage; putative methyltransferase YfdM
Synonym(s): YfdM, YzyB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.336
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence
18 -> 89 HELKEVGDQWRTPDNIFWGINTLFGPFVLDLFTDGDNAKCAAYYTAEDNALAHDWSERLAELKGAAFGNPPY

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0009007 - site-specific DNA-methyltransferase (adenine-specific) activity
biological_process GO:0016032 - viral process
GO:0032259 - methylation
GO:0032775 - DNA methylation on adenine
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7225-MONOMER
ECOLIWIKI:
b2356
ECOO157CYC:
Z1454-MONOMER
ECOO157CYC:
Z3349-MONOMER
INTERPRO:
IPR008593
PFAM:
PF05869
PRIDE:
P76509
PROSITE:
PS00092
REFSEQ:
NP_416857
SMR:
P76509
UNIPROT:
P76509


Operon      
Name: yfdONMLK         
Operon arrangement:
Transcription unit        Promoter
yfdONMLK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB