RegulonDB RegulonDB 10.9: Gene Form
   

pyrS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrS alaC pyrR SgrR terminator alaCp alaCp TSS_2671 TSS_2671

Gene      
Name: pyrS    Texpresso search in the literature
Synonym(s): ECK2376, G7243, b2380, ypdA
Genome position(nucleotides): 2498671 --> 2500368 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.41
External database links:  
ASAP:
ABE-0007855
ECHOBASE:
EB3900
ECOLIHUB:
ypdA
OU-MICROARRAY:
b2380
STRING:
511145.b2380
COLOMBOS: pyrS


Product      
Name: sensor histidine kinase PyrS
Synonym(s): PyrS, YpdA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 62.657
Isoelectric point: 7.761
Motif(s):
 
Type Positions Sequence
4 -> 24 IFNMLLAVFDRAALMLICLFF
173 -> 193 IGIPMILGSVCIGFIVLLVQS
343 -> 554 QLEVSRAEQLREMANKAELRALQSKINPHFLFNALNAISSSIRLNPDTARQLIFNLSRYLRYNIELKDDEQIDIKKELYQIKDYIAIEQARFGDKLTVIYDIDEEVNCCIPSLLIQPLVENAIVHGIQPCKGKGVVTISVAECGNRVRIAVRDTGHGIDPKVIERVEANEMPGNKIGLLNVHHRVKLLYGEGLHIRRLEPGTEIAFYIPNQR
108 -> 128 GVTAIPCFITSILAGCISGWI
140 -> 160 VGILGGMLCETLTMILVIVWA

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0018106 - peptidyl-histidine phosphorylation
GO:0071555 - cell wall organization
GO:0023014 - signal transduction by protein phosphorylation
GO:0031670 - cellular response to nutrient
Note(s): Note(s): ...[more].
Reference(s): [1] DeLisa MP., et al., 2001
[2] Oshima T., et al., 2002
[3] Tchieu JH., et al., 2001
External database links:  
ECOCYC:
G7243-MONOMER
ECOLIWIKI:
b2380
INTERPRO:
IPR003594
INTERPRO:
IPR010559
INTERPRO:
IPR011620
INTERPRO:
IPR029016
INTERPRO:
IPR036890
MODBASE:
P0AA93
PFAM:
PF07694
PFAM:
PF06580
PFAM:
PF02518
PRIDE:
P0AA93
REFSEQ:
NP_416881
SMART:
SM00387
SMR:
P0AA93
UNIPROT:
P0AA93


Operon      
Name: pyrSR-ypdC         
Operon arrangement:
Transcription unit        Promoter
pyrSR-ypdC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2671 2498356 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] DeLisa MP., Wu CF., Wang L., Valdes JJ., Bentley WE., 2001, DNA microarray-based identification of genes controlled by autoinducer 2-stimulated quorum sensing in Escherichia coli., J Bacteriol 183(18):5239-47

 [2] Oshima T., Aiba H., Masuda Y., Kanaya S., Sugiura M., Wanner BL., Mori H., Mizuno T., 2002, Transcriptome analysis of all two-component regulatory system mutants of Escherichia coli K-12., Mol Microbiol 46(1):281-91

 [3] Tchieu JH., Norris V., Edwards JS., Saier MH., 2001, The complete phosphotransferase system in Escherichia coli., J Mol Microbiol Biotechnol 3(3):329-46

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB