RegulonDB RegulonDB 10.9: Gene Form
   

ypeC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfeO mntH ypeC terminator

Gene      
Name: ypeC    Texpresso search in the literature
Synonym(s): ECK2386, G7252, b2390
Genome position(nucleotides): 2511001 --> 2511327 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.13
External database links:  
ASAP:
ABE-0007883
ECHOBASE:
EB4128
ECOLIHUB:
ypeC
OU-MICROARRAY:
b2390
STRING:
511145.b2390
COLOMBOS: ypeC


Product      
Name: DUF2502 domain-containing protein YpeC
Synonym(s): YpeC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.263
Isoelectric point: 10.526
Motif(s):
 
Type Positions Sequence
23 -> 106 EITLLPSIKLQIGDRDHYGNYWDGGHWRDRDYWHRNYEWRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGKGRGHGH
22 -> 108 GEITLLPSIKLQIGDRDHYGNYWDGGHWRDRDYWHRNYEWRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGKGRGHGHRH
1 -> 21 MFRSLFLAAALMAFTPLAANA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7252-MONOMER
ECOLIWIKI:
b2390
INTERPRO:
IPR019638
PFAM:
PF10697
PRIDE:
P64542
REFSEQ:
NP_416891
UNIPROT:
P64542


Operon      
Name: ypeC         
Operon arrangement:
Transcription unit        Promoter
ypeC


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB