RegulonDB RegulonDB 10.9: Gene Form
   

insL3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeA nupC insL3 TSS_2678 TSS_2678 insLp5 insLp5

Gene      
Name: insL3    Texpresso search in the literature
Synonym(s): ECK0016, G7255, b2394, yi81-3
Genome position(nucleotides): 2514331 --> 2515443 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.93
External database links:  
ASAP:
ABE-0007897
ECHOBASE:
EB4758
ECOLIHUB:
insL-3
OU-MICROARRAY:
b2394
STRING:
511145.b2394
COLOMBOS: insL3


Product      
Name: putative IS186/IS421 transposase
Synonym(s): InsL3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.909
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
107 -> 348 SGKRLRLVDGTAISAPGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECIRSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGAPFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28060N
ECOCYC:
G7255-MONOMER
ECOLIWIKI:
b2394
INTERPRO:
IPR002559
INTERPRO:
IPR012337
INTERPRO:
IPR014736
MODBASE:
P0CF93
PFAM:
PF01609
PRIDE:
P0CF93
REFSEQ:
NP_416895
UNIPROT:
P0CF93


Operon      
Name: insL3         
Operon arrangement:
Transcription unit        Promoter
insL3


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insLp5 2514322 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2678 2514349 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB