RegulonDB RegulonDB 10.9: Gene Form
   

yfeK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdxK yfeS yfeK pdxKp1 pdxKp1 yfeKp yfeKp TSS_2733 (cluster) TSS_2733 (cluster)

Gene      
Name: yfeK    Texpresso search in the literature
Synonym(s): ECK2414, G7260, b2419
Genome position(nucleotides): 2537342 --> 2537716 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.4
External database links:  
ASAP:
ABE-0007977
ECHOBASE:
EB2520
ECOLIHUB:
yfeK
OU-MICROARRAY:
b2419
STRING:
511145.b2419
COLOMBOS: yfeK


Product      
Name: DUF5329 domain-containing protein YfeK
Synonym(s): YfeK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.732
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
24 -> 115 HEEARINAMLEGLAQKKDLIFVRNGDEHTCYEAVSHLRLKLGNTRNRIDTAEQFIDKVASSSSITGKPYIVKIPGKSDENAQPFLHALIAQT
1 -> 19 MKKIICLVITLLMTLPVYA
20 -> 124 KLTAHEEARINAMLEGLAQKKDLIFVRNGDEHTCYEAVSHLRLKLGNTRNRIDTAEQFIDKVASSSSITGKPYIVKIPGKSDENAQPFLHALIAQTDKTVPAEGN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7260-MONOMER
ECOLIWIKI:
b2419
INTERPRO:
IPR035242
PFAM:
PF17263
PRIDE:
Q47702
REFSEQ:
NP_416914
UNIPROT:
Q47702


Operon      
Name: yfeKS         
Operon arrangement:
Transcription unit        Promoter
yfeKS


Regulation by small RNA    
  Display Regulation
small RNA micA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2733 (cluster) 2537277 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB