RegulonDB RegulonDB 10.9: Gene Form
   

yfeS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysM yfeS yfeK TSS_2735 TSS_2735 TSS_2734 TSS_2734

Gene      
Name: yfeS    Texpresso search in the literature
Synonym(s): ECK2415, G7261, b2420
Genome position(nucleotides): 2537749 --> 2538483 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.18
External database links:  
ASAP:
ABE-0007979
ECHOBASE:
EB3912
ECOLIHUB:
yfeS
ECOO157CYC:
MOLR_A
OU-MICROARRAY:
b2420
STRING:
511145.b2420
COLOMBOS: yfeS


Product      
Name: PF05406 family protein YfeS
Synonym(s): YfeS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 28.243
Isoelectric point: 4.762
Motif(s):
 
Type Positions Sequence
9 -> 71 DEKSNKFWWIDYEGDSLAVNYGKVGSIGKFQTKEFDNEEQCLKEASKLIAAKMKKGYQEDPKF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7261-MONOMER
ECOLIWIKI:
b2420
ECOO157CYC:
MOLR_A-MONOMER
INTERPRO:
IPR008893
INTERPRO:
IPR016835
INTERPRO:
IPR036930
PFAM:
PF05406
PRIDE:
P78271
REFSEQ:
NP_416915
SMART:
SM00773
SMR:
P78271
UNIPROT:
P78271


Operon      
Name: yfeKS         
Operon arrangement:
Transcription unit        Promoter
yfeKS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2734 2539529 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2735 2539540 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB