RegulonDB RegulonDB 10.9: Gene Form
   

murR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murQ murR ucpA MurR MurR MurR CRP murRp murRp murQp2 murQp2 murQp1 murQp1 TSS_2743 TSS_2743 ucpAp2 ucpAp2 ucpAp1 ucpAp1

Gene      
Name: murR    Texpresso search in the literature
Synonym(s): ECK2422, G7262, b2427, yfeT
Genome position(nucleotides): 2544752 <-- 2545609 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.63
External database links:  
ASAP:
ABE-0008000
ECHOBASE:
EB3913
ECOLIHUB:
murR
OU-MICROARRAY:
b2427
STRING:
511145.b2427
COLOMBOS: murR


Product      
Name: DNA-binding transcriptional dual regulator MurR
Synonym(s): MurR, YfeT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: RpiR
Molecular weight: 31.192
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
132 -> 260 ISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFV
37 -> 56 SRQMAKQLGISQSSIVKFAQ
1 -> 77 MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSAS
128 -> 268 IIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0097367 - carbohydrate derivative binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0043470 - regulation of carbohydrate catabolic process
GO:1901135 - carbohydrate derivative metabolic process
GO:0097173 - N-acetylmuramic acid catabolic process
External database links:  
DIP:
DIP-12018N
ECOCYC:
G7262-MONOMER
ECOLIWIKI:
b2427
INTERPRO:
IPR001347
INTERPRO:
IPR000281
INTERPRO:
IPR009057
INTERPRO:
IPR036388
INTERPRO:
IPR035472
INTERPRO:
IPR022821
MODBASE:
P77245
PFAM:
PF01380
PFAM:
PF01418
PRIDE:
P77245
PRODB:
PRO_000023322
PROSITE:
PS51071
PROSITE:
PS51464
REFSEQ:
NP_416922
SMR:
P77245
UNIPROT:
P77245


Operon      
Name: murR         
Operon arrangement:
Transcription unit        Promoter
murR
murR


Transcriptional Regulation      
Display Regulation             
Activated by: MurR
Repressed by: MurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2743 2544672 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB