RegulonDB RegulonDB 10.9: Gene Form
   

yfeX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfeW yfeX yfeY anti-anti-terminator anti-terminator terminator yfeXp5 yfeXp5 TSS_2746 TSS_2746 yfeXp3 yfeXp3 TSS_2745 TSS_2745

Gene      
Name: yfeX    Texpresso search in the literature
Synonym(s): ECK2426, G7266, b2431
Genome position(nucleotides): 2549646 <-- 2550545 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.0
External database links:  
ASAP:
ABE-0008015
ECHOBASE:
EB3917
ECOLIHUB:
yfeX
OU-MICROARRAY:
b2431
STRING:
511145.b2431
COLOMBOS: yfeX


Product      
Name: porphyrinogen peroxidase
Synonym(s): YfeX, dye-decolorizing peroxidase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.052
Isoelectric point: 5.245
Motif(s):
 
Type Positions Sequence
215 -> 215 H
5 -> 295 QSGILPEHCRAAIWIEANVKGEVDALRAASKTFADKLATFEAKFPDAHLGAVVAFGNNTWRALSGGVGAEELKDFPGYGKGLAPTTQFDVLIHILSLRHDVNFSVAQAAMEAFGDCIEVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVHDQEMVIGRTKEANEEIDGDERPETSHLTRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLHNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLDK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0020037 - heme binding
biological_process GO:0055114 - oxidation-reduction process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Price MN., et al., 2018
External database links:  
DIP:
DIP-47971N
ECOCYC:
G7266-MONOMER
ECOLIWIKI:
b2431
INTERPRO:
IPR006314
INTERPRO:
IPR011008
PFAM:
PF04261
PRIDE:
P76536
PROSITE:
PS51404
REFSEQ:
NP_416926
SMR:
P76536
UNIPROT:
P76536


Operon      
Name: yfeYX         
Operon arrangement:
Transcription unit        Promoter
yfeYX


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2745 2549935 forward nd [RS-EPT-CBR] [2]
  promoter yfeXp3 2550554 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2746 2550590 reverse nd [RS-EPT-CBR] [2]
  promoter yfeXp5 2550678 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Price MN., Wetmore KM., Waters RJ., Callaghan M., Ray J., Liu H., Kuehl JV., Melnyk RA., Lamson JS., Suh Y., Carlson HK., Esquivel Z., Sadeeshkumar H., Chakraborty R., Zane GM., Rubin BE., Wall JD., Visel A., Bristow J., Blow MJ., Arkin AP., Deutschbauer AM., 2018, Mutant phenotypes for thousands of bacterial genes of unknown function., Nature 557(7706):503-509

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB