RegulonDB RegulonDB 10.9: Gene Form
   

eutK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutR eutL eutK

Gene      
Name: eutK    Texpresso search in the literature
Synonym(s): ECK2433, G7270, b2438, yffI
Genome position(nucleotides): 2555228 <-- 2555728 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.08
External database links:  
ASAP:
ABE-0008039
ECHOBASE:
EB3922
ECOLIHUB:
eutK
OU-MICROARRAY:
b2438
STRING:
511145.b2438
COLOMBOS: eutK


Product      
Name: putative structural protein, ethanolamine utilization microcompartment
Synonym(s): EutK, YffI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.893
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
4 -> 79 ALGLLEVDGMVAAIDAADAMLKAANVRLLSHEVLDPGRLTLVVEGDLAACRAALDAGCAAAMRTGRVISRKEIGRP
17 -> 166 IDAADAMLKAANVRLLSHEVLDPGRLTLVVEGDLAACRAALDAGCAAAMRTGRVISRKEIGRPDDDTQWLVTGFNRQPKQPVREPDAPVIVAESADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYRLKPH
1 -> 16 MINALGLLEVDGMVAA
109 -> 162 ESADELLALLTSVRQGMTAGEVAAHFGWPLEKARNALEQLFSAGTLRKRSSRYR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0003676 - nucleic acid binding
GO:0005198 - structural molecule activity
biological_process GO:0010165 - response to X-ray
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Sargentini NJ., et al., 2016
[2] Tanaka S., et al., 2010
External database links:  
ECOCYC:
G7270-MONOMER
ECOLIWIKI:
b2438
INTERPRO:
IPR020808
INTERPRO:
IPR037233
INTERPRO:
IPR036388
INTERPRO:
IPR000249
INTERPRO:
IPR032298
PDB:
3I71
PFAM:
PF00936
PFAM:
PF16365
PRIDE:
P76540
PRODB:
PRO_000022543
PROSITE:
PS01139
REFSEQ:
NP_416933
SMART:
SM00877
SMR:
P76540
UNIPROT:
P76540


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
eutBCLKR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Tanaka S., Sawaya MR., Yeates TO., 2010, Structure and mechanisms of a protein-based organelle in Escherichia coli., Science 327(5961):81-4


RegulonDB