RegulonDB RegulonDB 10.9: Gene Form
   

eutH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutA eutH eutG yffS eutJ TSS_2748 TSS_2748

Gene      
Name: eutH    Texpresso search in the literature
Synonym(s): ECK2447, G7282, b2452, yffU
Genome position(nucleotides): 2566881 <-- 2568107 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.18
External database links:  
ASAP:
ABE-0008081
ECHOBASE:
EB3934
ECOLIHUB:
eutH
OU-MICROARRAY:
b2452
STRING:
511145.b2452
COLOMBOS: eutH


Product      
Name: putative ethanolamine permease EutH
Synonym(s): EutH, YffU
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 42.807
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
126 -> 146 ILGSMMGPTIVFSIPVALGII
192 -> 212 FALILMNMIPVIIVAILVALG
230 -> 250 FLVALITLGLAAAVVKFLLGW
313 -> 333 NIAAAGMVATLANNIPMFGMM
3 -> 391 INEIIMYIMMFFMLIAAVDRILSQFGGSARFLGKFGKSIEGSGGQFEEGFMAMGALGLAMVGMTALAPVLAHVLGPVIIPVYEMLGANPSMFAGTLLACDMGGFFLAKELAGGDVAAWLYSGLILGSMMGPTIVFSIPVALGIIEPSDRRYLALGVLAGIVTIPIGCIAGGLVAMYSGVQINGQPVEFTFALILMNMIPVIIVAILVALGLKFIPEKMINGFQIFAKFLVALITLGLAAAVVKFLLGWELIPGLDPIFMAPGDKPGEVMRAIEVIGSISCVLLGAYPMVLLLTRWFEKPLMSVGKVLNMNNIAAAGMVATLANNIPMFGMMKQMDTRGKVINCAFAVSAAFALGDHLGFAAANMNAMIFPMIVGKLIGGVTAIGVAMML

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0034228 - ethanolamine transmembrane transporter activity
biological_process GO:0046336 - ethanolamine catabolic process
GO:0034229 - ethanolamine transport
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Kofoid E., et al., 1999
External database links:  
DIP:
DIP-9533N
ECOCYC:
G7282-MONOMER
ECOLIWIKI:
b2452
INTERPRO:
IPR007441
PANTHER:
PTHR40089
PFAM:
PF04346
PRIDE:
P76552
PRODB:
PRO_000022541
REFSEQ:
NP_416947
UNIPROT:
P76552


Operon      
Name: eutHA         
Operon arrangement:
Transcription unit        Promoter
eutHA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2748 2564868 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kofoid E., Rappleye C., Stojiljkovic I., Roth J., 1999, The 17-gene ethanolamine (eut) operon of Salmonella typhimurium encodes five homologues of carboxysome shell proteins., J Bacteriol 181(17):5317-29

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB