RegulonDB RegulonDB 10.8: Gene Form
   

eutN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutE eutM eutN

Gene      
Name: eutN    Texpresso search in the literature
Synonym(s): ECK2451, G7286, b2456, cchB, yffY
Genome position(nucleotides): 2571763 <-- 2572050 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.12
External database links:  
ASAP:
ABE-0008093
ECHOBASE:
EB3938
OU-MICROARRAY:
b2456
PortEco:
eutN
STRING:
511145.b2456
COLOMBOS: eutN


Product      
Name: putative ethanolamine catabolic microcompartment shell protein EutN
Synonym(s): CchB, EutN, YffY, putative carboxysome structural protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.956
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
1 -> 83 MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0046336 - ethanolamine catabolic process
GO:0034214 - protein hexamerization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7286-MONOMER
ECOLIWIKI:
b2456
INTERPRO:
IPR036677
INTERPRO:
IPR004992
PANTHER:
PTHR36539
PDB:
2Z9H
PDB:
2HD3
PFAM:
PF03319
PRIDE:
P0AEJ8
PRODB:
PRO_000022546
PRODOM:
PD012510
REFSEQ:
NP_416951
SMR:
P0AEJ8
UNIPROT:
P0AEJ8


Operon      
Name: eutNEJG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB