RegulonDB RegulonDB 10.9: Gene Form
   

eutN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutE eutM eutN

Gene      
Name: eutN    Texpresso search in the literature
Synonym(s): ECK2451, G7286, b2456, cchB, yffY
Genome position(nucleotides): 2571763 <-- 2572050 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.12
External database links:  
ASAP:
ABE-0008093
ECHOBASE:
EB3938
ECOLIHUB:
eutN
OU-MICROARRAY:
b2456
STRING:
511145.b2456
COLOMBOS: eutN


Product      
Name: putative ethanolamine catabolic microcompartment shell protein EutN
Synonym(s): CchB, EutN, YffY, putative carboxysome structural protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.956
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
1 -> 83 MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0046336 - ethanolamine catabolic process
GO:0034214 - protein hexamerization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7286-MONOMER
ECOLIWIKI:
b2456
INTERPRO:
IPR036677
INTERPRO:
IPR004992
PANTHER:
PTHR36539
PDB:
2HD3
PDB:
2Z9H
PFAM:
PF03319
PRIDE:
P0AEJ8
PRODB:
PRO_000022546
REFSEQ:
NP_416951
SMR:
P0AEJ8
UNIPROT:
P0AEJ8


Operon      
Name: eutNEJG         
Operon arrangement:
Transcription unit        Promoter
eutNEJG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB