RegulonDB RegulonDB 10.8: Gene Form
   

eutM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutD eutM eutN eutT

Gene      
Name: eutM    Texpresso search in the literature
Synonym(s): ECK2452, G7287, b2457, cchA, yffZ
Genome position(nucleotides): 2572157 <-- 2572450 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.16
External database links:  
ASAP:
ABE-0008095
ECHOBASE:
EB3939
OU-MICROARRAY:
b2457
PortEco:
eutM
STRING:
511145.b2457
COLOMBOS: eutM


Product      
Name: putative ethanolamine catabolic microcompartment shell protein EutM
Synonym(s): CchA, EutM, YffZ, putative structural protein, ethanolamine utilization microcompartment
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.866
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
26 -> 97 ARVKLVGVKQIGGGLCTAMVRGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPIGLKGDSSNL
1 -> 25 MEALGMIETRGLVALIEASDAMVKA
3 -> 78 ALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLCTAMVRGDVAACKAATDAGAAAAQRIGELVSVHVIPRP

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0005198 - structural molecule activity
GO:0042802 - identical protein binding
biological_process GO:0046336 - ethanolamine catabolic process
GO:0034214 - protein hexamerization
External database links:  
DIP:
DIP-9537N
ECOCYC:
G7287-MONOMER
ECOLIWIKI:
b2457
INTERPRO:
IPR037233
INTERPRO:
IPR020808
INTERPRO:
IPR000249
PDB:
3MPW
PDB:
3I6P
PDB:
3MPY
PFAM:
PF00936
PRIDE:
P0ABF4
PRODB:
PRO_000022545
PROSITE:
PS01139
REFSEQ:
NP_416952
SMART:
SM00877
SMR:
P0ABF4
SWISSMODEL:
P0ABF4
UNIPROT:
P0ABF4


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB