RegulonDB RegulonDB 10.9: Gene Form
   

eutM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutD eutM eutN eutT

Gene      
Name: eutM    Texpresso search in the literature
Synonym(s): ECK2452, G7287, b2457, cchA, yffZ
Genome position(nucleotides): 2572157 <-- 2572450 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.16
External database links:  
ASAP:
ABE-0008095
ECHOBASE:
EB3939
ECOLIHUB:
eutM
OU-MICROARRAY:
b2457
STRING:
511145.b2457
COLOMBOS: eutM


Product      
Name: putative ethanolamine catabolic microcompartment shell protein EutM
Synonym(s): CchA, EutM, YffZ, putative structural protein, ethanolamine utilization microcompartment
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.866
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
26 -> 97 ARVKLVGVKQIGGGLCTAMVRGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPIGLKGDSSNL
1 -> 25 MEALGMIETRGLVALIEASDAMVKA
3 -> 78 ALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLCTAMVRGDVAACKAATDAGAAAAQRIGELVSVHVIPRP

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0005198 - structural molecule activity
GO:0042802 - identical protein binding
biological_process GO:0046336 - ethanolamine catabolic process
GO:0034214 - protein hexamerization
External database links:  
DIP:
DIP-9537N
ECOCYC:
G7287-MONOMER
ECOLIWIKI:
b2457
INTERPRO:
IPR020808
INTERPRO:
IPR000249
INTERPRO:
IPR037233
PDB:
3MPY
PDB:
3MPW
PDB:
3I6P
PFAM:
PF00936
PRIDE:
P0ABF4
PRODB:
PRO_000022545
PROSITE:
PS01139
REFSEQ:
NP_416952
SMART:
SM00877
SMR:
P0ABF4
SWISSMODEL:
P0ABF4
UNIPROT:
P0ABF4


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
eutSPQTDM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB