RegulonDB RegulonDB 10.9: Gene Form
   

eutT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutD eutT eutQ eutP eutM

Gene      
Name: eutT    Texpresso search in the literature
Synonym(s): ECK2454, G7289, b2459, ypfB
Genome position(nucleotides): 2573502 <-- 2574305 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.58
External database links:  
ASAP:
ABE-0008100
ECHOBASE:
EB3941
ECOLIHUB:
eutT
OU-MICROARRAY:
b2459
STRING:
511145.b2459
COLOMBOS: eutT


Product      
Name: putative ethanolamine utilization cobalamin adenosyltransferase
Synonym(s): EutT, YpfB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.172
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
95 -> 246 THLSAEKMVAKSDPRLGFRAVLDSTIALAVWLQIELAEPWQPWLADIRSRLGNIMRADALGEPLGCQAIVGLSDEDLHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETETVAAQVFITRSFEVLRPDILQALNRLSSTVYVMMI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008817 - cob(I)yrinic acid a,c-diamide adenosyltransferase activity
biological_process GO:0009236 - cobalamin biosynthetic process
GO:0006580 - ethanolamine metabolic process
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9543N
ECOCYC:
G7289-MONOMER
ECOLIWIKI:
b2459
INTERPRO:
IPR009194
INTERPRO:
IPR016030
INTERPRO:
IPR036451
PFAM:
PF01923
PRIDE:
P65643
PRODB:
PRO_000022551
REFSEQ:
NP_416954
UNIPROT:
P65643


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
eutSPQTDM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB