RegulonDB RegulonDB 11.1: Gene Form
   

eutQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutD eutT eutQ eutP eutS

Gene      
Name: eutQ    Texpresso search in the literature
Synonym(s): ECK2455, G7290, b2460, ypfC
Genome position(nucleotides): 2574302 <-- 2575003
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.98
External database links:  
ASAP:
ABE-0008102
ECHOBASE:
EB3942
ECOLIHUB:
eutQ
OU-MICROARRAY:
b2460
STRING:
511145.b2460
COLOMBOS: eutQ


Product      
Name: putative ethanolamine utilization acetate kinase EutQ
Synonym(s): EutQ, YpfC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.418
Isoelectric point: 4.584
Motif(s):
 
Type Positions Sequence Comment
85 -> 232 FTESLVAQLMEKVMKEKQSLEQGAMQPSFKSVTGKGGIKVIDGSSVKFGRFDGAEPHCVGLTDLVTGDDGSSMAAGFMQWENAFFPWTLNYDEIDMVLEGELHVRHEGQTMIAKAGDVMFIPKGSSIEFGTTSSVKFLYVAWPANWQS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008776 - acetate kinase activity
biological_process GO:0016310 - phosphorylation
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P76555
DIP:
DIP-9540N
ECOCYC:
G7290-MONOMER
ECOLIWIKI:
b2460
INTERPRO:
IPR011051
INTERPRO:
IPR010424
INTERPRO:
IPR014710
MODBASE:
P76555
PANTHER:
PTHR36169
PFAM:
PF06249
PRIDE:
P76555
PRODB:
PRO_000022548
REFSEQ:
NP_416955
SMR:
P76555
UNIPROT:
P76555


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
eutSPQTDM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB