RegulonDB RegulonDB 10.9: Gene Form
   

eutP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutT eutQ eutP eutS eutD

Gene      
Name: eutP    Texpresso search in the literature
Synonym(s): ECK2456, G7291, b2461, ypfD
Genome position(nucleotides): 2574978 <-- 2575457 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.79
External database links:  
ASAP:
ABE-0008105
ECHOBASE:
EB3943
ECOLIHUB:
eutP
OU-MICROARRAY:
b2461
STRING:
511145.b2461
COLOMBOS: eutP


Product      
Name: putative ethanolamine utilization acetate kinase EutP
Synonym(s): EutP, YpfD, putative ethanolamine utilization protein EutP with nucleoside triphosphate hydrolase domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.659
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
1 -> 143 MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLA
8 -> 15 GSVGAGKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006576 - cellular biogenic amine metabolic process
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7291-MONOMER
ECOLIWIKI:
b2461
INTERPRO:
IPR027417
INTERPRO:
IPR012381
MODBASE:
P76556
PANTHER:
PTHR40453
PFAM:
PF10662
PRIDE:
P76556
PRODB:
PRO_000022547
REFSEQ:
NP_416956
UNIPROT:
P76556


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
eutSPQTDM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB