RegulonDB RegulonDB 10.8: Gene Form
   

eutP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutT eutQ eutP eutS eutD

Gene      
Name: eutP    Texpresso search in the literature
Synonym(s): ECK2456, G7291, b2461, ypfD
Genome position(nucleotides): 2574978 <-- 2575457 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.79
External database links:  
ASAP:
ABE-0008105
ECHOBASE:
EB3943
OU-MICROARRAY:
b2461
PortEco:
eutP
STRING:
511145.b2461
COLOMBOS: eutP


Product      
Name: putative ethanolamine utilization acetate kinase EutP
Synonym(s): EutP, YpfD, putative ethanolamine utilization protein EutP with nucleoside triphosphate hydrolase domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.659
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
1 -> 143 MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLA
8 -> 15 GSVGAGKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006576 - cellular biogenic amine metabolic process
GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7291-MONOMER
ECOLIWIKI:
b2461
INTERPRO:
IPR027417
INTERPRO:
IPR012381
MODBASE:
P76556
PANTHER:
PTHR40453
PFAM:
PF10662
PRIDE:
P76556
PRODB:
PRO_000022547
REFSEQ:
NP_416956
SMR:
P76556
UNIPROT:
P76556


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB