RegulonDB RegulonDB 10.9: Gene Form
   

eutS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeB eutP eutS eutQ

Gene      
Name: eutS    Texpresso search in the literature
Synonym(s): ECK2457, G7292, b2462, ypfE
Genome position(nucleotides): 2575470 <-- 2575805 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.6
External database links:  
ASAP:
ABE-0008108
ECHOBASE:
EB3944
ECOLIHUB:
eutS
OU-MICROARRAY:
b2462
STRING:
511145.b2462
COLOMBOS: eutS


Product      
Name: putative ethanolamine catabolic microcompartment shell protein EutS
Synonym(s): EutS, YpfE, putative structural protein, ethanolamine utilization microcompartment
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.65
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
40 -> 105 AIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0031469 - polyhedral organelle
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0005198 - structural molecule activity
GO:0042802 - identical protein binding
biological_process GO:0046336 - ethanolamine catabolic process
GO:0034214 - protein hexamerization
External database links:  
ECOCYC:
G7292-MONOMER
ECOLIWIKI:
b2462
INTERPRO:
IPR009307
INTERPRO:
IPR037233
INTERPRO:
IPR000249
PANTHER:
PTHR40449
PDB:
3IA0
PDB:
3I96
PFAM:
PF00936
PRIDE:
P63746
PRODB:
PRO_000022550
REFSEQ:
NP_416957
SMART:
SM00877
SMR:
P63746
UNIPROT:
P63746


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
eutSPQTDM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB