RegulonDB RegulonDB 10.8: Gene Form
   

eutS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeB eutP eutS eutQ

Gene      
Name: eutS    Texpresso search in the literature
Synonym(s): ECK2457, G7292, b2462, ypfE
Genome position(nucleotides): 2575470 <-- 2575805 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.6
External database links:  
ASAP:
ABE-0008108
ECHOBASE:
EB3944
OU-MICROARRAY:
b2462
PortEco:
eutS
STRING:
511145.b2462
COLOMBOS: eutS


Product      
Name: putative ethanolamine catabolic microcompartment shell protein EutS
Synonym(s): EutS, YpfE, putative structural protein, ethanolamine utilization microcompartment
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.65
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
40 -> 105 AIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0031469 - polyhedral organelle
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0005198 - structural molecule activity
GO:0042802 - identical protein binding
biological_process GO:0046336 - ethanolamine catabolic process
GO:0034214 - protein hexamerization
External database links:  
ECOCYC:
G7292-MONOMER
ECOLIWIKI:
b2462
INTERPRO:
IPR000249
INTERPRO:
IPR037233
INTERPRO:
IPR009307
PANTHER:
PTHR40449
PDB:
3IA0
PDB:
3I96
PFAM:
PF00936
PRIDE:
P63746
PRODB:
PRO_000022550
REFSEQ:
NP_416957
SMART:
SM00877
SMR:
P63746
UNIPROT:
P63746


Operon      
Name: eutSPQTDM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB