RegulonDB RegulonDB 10.9: Gene Form
   

hyfF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: hyfF    Texpresso search in the literature
Synonym(s): ECK2482, G7303, b2486
Genome position(nucleotides): 2606917 --> 2608497 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0008191
ECHOBASE:
EB3966
ECOLIHUB:
hyfF
OU-MICROARRAY:
b2486
STRING:
511145.b2486
COLOMBOS: hyfF


Product      
Name: hydrogenase 4 component F
Synonym(s): HyfF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.767
Isoelectric point: 8.39
Motif(s):
 
Type Positions Sequence
75 -> 95 LGGLFLAILGVIGFLTGIYSI
256 -> 276 LLSAVLLNCALLVLIRYYIII
69 -> 102 WLHIDGLGGLFLAILGVIGFLTGIYSIGYMRHEV
286 -> 306 NRLLLIFGMLSVAVAAFFILV
168 -> 188 YIIICTVGVAFGLFGTVLVYA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0016491 - oxidoreductase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-143
ECOLIWIKI:
b2486
INTERPRO:
IPR001750
INTERPRO:
IPR001516
PFAM:
PF00361
PFAM:
PF00662
PRIDE:
P77437
PRODB:
PRO_000022968
REFSEQ:
NP_416981
UNIPROT:
P77437


Operon      
Name: hyfABCDEFGHIJR-focB         
Operon arrangement:
Transcription unit        Promoter
hyfABCDEFGHIJR-focB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FhlA, HyfR
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB