RegulonDB RegulonDB 10.8: Gene Form
   

yfgD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bepA hda yfgD TSS_2778 TSS_2778 TSS_2777 TSS_2777 TSS_2776 TSS_2776 TSS_2775 TSS_2775

Gene      
Name: yfgD    Texpresso search in the literature
Synonym(s): ECK2491, G7312, b2495
Genome position(nucleotides): 2617578 --> 2617937 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
External database links:  
ASAP:
ABE-0008214
ECHOBASE:
EB3952
OU-MICROARRAY:
b2495
PortEco:
yfgD
STRING:
511145.b2495
COLOMBOS: yfgD


Product      
Name: putative oxidoreductase YfgD
Synonym(s): YfgD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.399
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
8 -> 117 YHNPRCSKSRETLNLLKENGVEPEVVLYLETPADAATLRDLLKILGMNSARELMRQKEDLYKELNLADSSLSEEALIQAMVDNPKLMERPIVVANGKARIGRPPEQVLEI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0008794 - arsenate reductase (glutaredoxin) activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7312-MONOMER
ECOLIWIKI:
b2495
INTERPRO:
IPR006659
INTERPRO:
IPR036249
INTERPRO:
IPR006660
MODBASE:
P76569
PFAM:
PF03960
PRIDE:
P76569
PROSITE:
PS51353
REFSEQ:
NP_416990
SMR:
P76569
SWISSMODEL:
P76569
UNIPROT:
P76569


Operon      
Name: bepA-yfgD         
Operon arrangement:
Transcription unit        Promoter
bepA-yfgD
bepA-yfgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2775 2617541 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2776 2617552 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2777 2617557 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2778 2617563 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB