RegulonDB RegulonDB 10.8: Gene Form
   

hda gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uraA hda yfgD TSS_2779 TSS_2779

Gene      
Name: hda    Texpresso search in the literature
Synonym(s): ECK2492, G7313, b2496, idaB, yfgE
Genome position(nucleotides): 2618075 <-- 2618776 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.85
External database links:  
ASAP:
ABE-0008217
ECHOBASE:
EB3953
OU-MICROARRAY:
b2496
PortEco:
hda
STRING:
511145.b2496
COLOMBOS: hda


Product      
Name: inibitor of reinitiation of DNA replication
Synonym(s): Hda, IdaB, YfgE, regulator of DnaA that prevents premature reinitiation of DNA replication
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 26.633
Isoelectric point: 5.156
Motif(s):
 
Type Positions Sequence
16 -> 212 DETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLD
136 -> 136 G
7 -> 11 LSLPL
167 -> 167 D
210 -> 210 Q

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0042802 - identical protein binding
GO:0043531 - ADP binding
biological_process GO:0006260 - DNA replication
GO:0006270 - DNA replication initiation
GO:0008156 - negative regulation of DNA replication
GO:0032297 - negative regulation of DNA-dependent DNA replication initiation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Felczak MM., et al., 2009
[2] Kato J., et al., 2001
[3] Kongsuwan K., et al., 2006
[4] Su'etsugu M., et al., 2004
External database links:  
DIP:
DIP-48006N
ECOCYC:
G7313-MONOMER
ECOLIWIKI:
b2496
INTERPRO:
IPR020591
INTERPRO:
IPR027417
INTERPRO:
IPR022864
INTERPRO:
IPR017788
INTERPRO:
IPR013317
PFAM:
PF00308
PRIDE:
P69931
PRINTS:
PR00051
PRODB:
PRO_000022867
REFSEQ:
NP_416991
SMR:
P69931
UNIPROT:
P69931


Operon      
Name: hda         
Operon arrangement:
Transcription unit        Promoter
hda


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2779 2618805 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Felczak MM., Kaguni JM., 2009, DnaAcos hyperinitiates by circumventing regulatory pathways that control the frequency of initiation in Escherichia coli., Mol Microbiol 72(6):1348-63

 [2] Kato J., Katayama T., 2001, Hda, a novel DnaA-related protein, regulates the replication cycle in Escherichia coli., EMBO J 20(15):4253-62

 [3] Kongsuwan K., Josh P., Picault MJ., Wijffels G., Dalrymple B., 2006, The plasmid RK2 replication initiator protein (TrfA) binds to the sliding clamp beta subunit of DNA polymerase III: implication for the toxicity of a peptide derived from the amino-terminal portion of 33-kilodalton TrfA., J Bacteriol 188(15):5501-9

 [4] Su'etsugu M., Takata M., Kubota T., Matsuda Y., Katayama T., 2004, Molecular mechanism of DNA replication-coupled inactivation of the initiator protein in Escherichia coli: interaction of DnaA with the sliding clamp-loaded DNA and the sliding clamp-Hda complex., Genes Cells 9(6):509-22

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB