RegulonDB RegulonDB 10.8: Gene Form
   

yfgG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeF yfgH yfgG FNR TSS_2784 TSS_2784 yfgHp10 yfgHp10 yfgGp yfgGp yfgGp5 yfgGp5 yfgGp6 yfgGp6 yfgGp7 yfgGp7 yfgFp yfgFp

Gene      
Name: yfgG    Texpresso search in the literature
Synonym(s): ECK2500, G7315, b2504
Genome position(nucleotides): 2629290 --> 2629481 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.48
External database links:  
ASAP:
ABE-0008247
ECHOBASE:
EB3955
OU-MICROARRAY:
b2504
PortEco:
yfgG
STRING:
511145.b2504
COLOMBOS: yfgG


Product      
Name: nickel/cobalt stress response protein YfgG
Synonym(s): YfgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.462
Isoelectric point: 12.398
Motif(s):
 
Type Positions Sequence
9 -> 62 KRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESPVQ
20 -> 40 IVLLISFIFFFGRFIYSSVGA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:1990532 - stress response to nickel ion
GO:0097501 - stress response to metal ion
Note(s): Note(s): ...[more].
Reference(s): [1] Price MN., et al., 2018
External database links:  
ECOCYC:
G7315-MONOMER
ECOLIWIKI:
b2504
INTERPRO:
IPR022576
PFAM:
PF11119
PRIDE:
P64545
PRODOM:
PD053432
REFSEQ:
NP_416999
UNIPROT:
P64545


Operon      
Name: yfgG         
Operon arrangement:
Transcription unit        Promoter
yfgG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfgGp7 2629085 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfgGp6 2629186 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfgGp5 2629252 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [2], [3]
  promoter yfgHp10 2629672 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2784 2629763 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Price MN., Wetmore KM., Waters RJ., Callaghan M., Ray J., Liu H., Kuehl JV., Melnyk RA., Lamson JS., Suh Y., Carlson HK., Esquivel Z., Sadeeshkumar H., Chakraborty R., Zane GM., Rubin BE., Wall JD., Visel A., Bristow J., Blow MJ., Arkin AP., Deutschbauer AM., 2018, Mutant phenotypes for thousands of bacterial genes of unknown function., Nature 557(7706):503-509

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB